IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ achour-2007-3 The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr A human placenta cDNA library was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation achour-2007-4 The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. human-hvts_sm1 Homo sapiens immortalized vascular smooth muscle cells (HVTs-SM1) hvts_sm1 Immortalized human vascular smooth muscle cells (HVTs-SM1) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr A human placenta cDNA library was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation achour-2007-5 The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. human-vsmc Homo sapiens aortic vascular smooth muscle cells vsmc Human aortic vascular smooth muscle cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr A human placenta cDNA library was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation achour-2007-1 The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr A human placenta cDNA library was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation achour-2007-2 The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr A human placenta cDNA library was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation achour-2007-6 The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. human-jurkat Homo sapiens jurkat Human T cell leukemia confocal microscopy confocal microscopy immunostaining immunostaining Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr A human placenta cDNA library was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation achour-2007-7 The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. human-hvts_sm1 Homo sapiens immortalized vascular smooth muscle cells (HVTs-SM1) hvts_sm1 Immortalized human vascular smooth muscle cells (HVTs-SM1) confocal microscopy confocal microscopy immunostaining immunostaining Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr A human placenta cDNA library was used. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation uhrf1_human E3 ubiquitin-protein ligase UHRF1 UHRF1 ICBP90 NP95 RNF106 Ubiquitin-like PHD and RING finger domain-containing protein 1 Ubiquitin-like-containing PHD and RING finger domains protein 1 Inverted CCAAT box-binding protein of 90 kDa Transcription factor ICBP90 Nuclear zinc finger protein Np95 Nuclear protein 95 RING finger protein 106 RING-type E3 ubiquitin transferase UHRF1 protein protein human Homo sapiens Human MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR dnmt1_human DNA (cytosine-5)-methyltransferase 1 CXXC9 MCMT DNA methyltransferase HsaI CXXC-type zinc finger protein 9 DNMT1 AIM DNMT protein protein human Homo sapiens Human MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA uhfr1-dnmt1 ICBP90 coimmunoprecipitates DNMT1 and HDAC1 in Jurkat lysates 676615 N/A 676622 unspecified role unspecified role bait bait N/A 676623 unspecified role unspecified role prey prey N/A 676624 unspecified role unspecified role prey prey association association false false false 3 A, S1 B Cells blocked in G1 by mimosine treatment showed higher levels of these interactions as compared to proliferating cells and confluent cells. Confluent cells showed the lowest levels of these interactions. Mimosine - These interactions were enhanced by mimosine-treatment, which blocks cells in late G1 and prevents entry into S phase. hdac1-dnmt1 ICBP90 and DNMT1 coimmunoprecipitate with HDAC1 in Jurkat lysates 676615 N/A 676623 unspecified role unspecified role prey prey N/A 676624 unspecified role unspecified role bait bait N/A 676622 unspecified role unspecified role prey prey association association false false false 3 B dnmt1-hdac1 ICBP90 and HDAC1 coimmunoprecipitate with DNMT1 in Jurkat lysates 676615 N/A 676622 unspecified role unspecified role prey prey N/A 676624 unspecified role unspecified role prey prey N/A 676623 unspecified role unspecified role bait bait association association false false false 3 B, S1 C uhfr1-hdac1 ICBP90 coimmunoprecipitates DNMT1 and HDAC1 in HVTs-SM1 lysates 676616 N/A 676624 unspecified role unspecified role prey prey N/A 676622 unspecified role unspecified role bait bait N/A 676623 unspecified role unspecified role prey prey association association false false false 4 A Mimosine - These interactions are enhanced by treatment of cells with mimosine, which blocks cells in late G1 phase and prevents entry into S phase. These interactions are enhanced in cells blocked in G1 phase as compared to proliferating cells. hdac1-dnmt1-2 ICBP90 and DNMT1 coimmunoprecipitate with HDAC1 in HVTs-SM1 lysates 676616 N/A 676622 unspecified role unspecified role prey prey N/A 676624 unspecified role unspecified role bait bait N/A 676623 unspecified role unspecified role prey prey association association false false false 4 B dnmt1-hdac1-3 ICBP90 and HDAC1 coimmunoprecipitate with DNMT1 in HVTs-SM1 lysates 676616 N/A 676624 unspecified role unspecified role prey prey N/A 676622 unspecified role unspecified role prey prey N/A 676623 unspecified role unspecified role bait bait association association false false false 4 B uhfr1-dnmt1-1 ICBP90 coimmunoprecipitates DNMT1 and HDAC1 in lysates from proliferating VSMCs 676617 N/A 676622 unspecified role unspecified role bait bait N/A 676623 unspecified role unspecified role prey prey N/A 676624 unspecified role unspecified role prey prey association association false false false S1 B These interactions occured in proliferating cells but not in confluent cells, due to lack of expression of ICBP90 at confluency. dnmt1-hdac1-4 ICBP90 and HDAC1 coimmunoprecipitate with DNMT1 in lysates from proliferating VSMCs 676617 N/A 676624 unspecified role unspecified role prey prey N/A 676623 unspecified role unspecified role bait bait N/A 676622 unspecified role unspecified role prey prey association association false false false S1 C These interactions occured in proliferating cells but not in confluent cells, due to lack of expression of ICBP90 at confluency. uhrf1-dnmt1 ICBP90 SRA domain interacts with DNMT1 (aa 401-615) in a yeast two-hybrid assay 676618 N/A 676623 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 676622 unspecified role unspecified role bait bait region SRA domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false dnmt1-uhfr1 GST-DNMT1 (aa 401-615) pulls down ICBP90 SRA domain (aa 400-660) in vitro 676619 N/A 676623 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 676622 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 2 dnmt1-uhfr1-1 DNMT1 and ICBP90 colocalize in Jurkat cells 676620 N/A 676623 unspecified role unspecified role neutral component neutral component N/A 676622 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5 C Colocalization occurred in the nucleus. dnmt1-uhfr1-2 DNMT1 and ICBP90 colocalize in HVTs-SM1 cells 676621 N/A 676622 unspecified role unspecified role neutral component neutral component N/A 676623 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6 C Colocalization occurred in the nucleus.