IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ torres-2007-3 E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation torres-2007-1 E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors confocal microscopy confocal microscopy immunostaining immunostaining Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation torres-2007-2 E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line confocal microscopy confocal microscopy immunostaining immunostaining Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation torres-2007-4 E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation torres-2007-5 E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. human-dld1 Human colorectal adenocarcinoma dld1 Human colon adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation torres-2007-6 E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 Only protein-protein interactions imex curation ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL cav1_canlf Caveolin-1 CAV1 CAV Vesicular integral-membrane protein VIP21 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET cadh1_human Cadherin-1 Epithelial cadherin Uvomorulin CAM 120/80 CDH1 CDHE UVO protein protein human Homo sapiens Human MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD cadh1_mouse Cadherin-1 Epithelial cadherin Uvomorulin ARC-1 Cdh1 protein protein mouse Mus musculus Mouse MGARCRSFSALLLLLQVSSWLCQELEPESCSPGFSSEVYTFPVPERHLERGHVLGRVRFEGCTGRPRTAFFSEDSRFKVATDGTITVKRHLKLHKLETSFLVRARDSSHRELSTKVTLKSMGHHHHRHHHRDPASESNPELLMFPSVYPGLRRQKRDWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDRESYPTYTLVVQAADLQGEGLSTTAKAVITVKDINDNAPVFNPSTYQGQVPENEVNARIATLKVTDDDAPNTPAWKAVYTVVNDPDQQFVVVTDPTTNDGILKTAKGLDFEAKQQYILHVRVENEEPFEGSLVPSTATVTVDVVDVNEAPIFMPAERRVEVPEDFGVGQEITSYTAREPDTFMDQKITYRIWRDTANWLEINPETGAIFTRAEMDREDAEHVKNSTYVALIIATDDGSPIATGTGTLLLVLLDVNDNAPIPEPRNMQFCQRNPQPHIITILDPDLPPNTSPFTAELTHGASVNWTIEYNDAAQESLILQPRKDLEIGEYKIHLKLADNQNKDQVTTLDVHVCDCEGTVNNCMKAGIVAAGLQVPAILGILGGILALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD ctnb1_canlf Catenin beta-1 CTNNB1 Beta-catenin protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTTQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL q95le0_canlf protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MGPRYGGAPALLLPLLLLLQVSSGLCQEPEPCRPGFGADSYTFTVPRRHLERGRVLGRVSFEGCTGLPRTAYVSDDTRFKVGTDGVITVKRPLQLHKPEISFLVHAWDSSRRKLSTRVRLKAATHHHHHHHDAPSKTQTEVLTFPSSQHGLRRQKRDWVIPPISCPENEKGPFP cav1-cdh1 Caveolin-1 coimmunoprecipitates E-cadherin and beta-catenin in HEK293T lysates 676675 N/A 676681 unspecified role unspecified role prey prey N/A 676682 unspecified role unspecified role bait bait N/A 676683 unspecified role unspecified role prey prey association association false false false 6 A P33724 transfection cav1-cdh1-2 Caveolin-1 coimmunoprecipitates E-cadherin and beta-catenin in HEK293T lysates 676675 N/A 676682 unspecified role unspecified role bait bait N/A 676684 unspecified role unspecified role prey prey N/A 676681 unspecified role unspecified role prey prey association association false false false 7 A P33724; P09803 transfection cav1-ctnnb1 Caveolin-1 and beta-catenin colocalize in HT-29(ATCC) cells 676676 N/A 676681 unspecified role unspecified role neutral component neutral component N/A 676682 unspecified role unspecified role neutral component neutral component physical association physical association false false false 3 A This colocalization took place in HT-29(ATCC) cells but nor HT-29(US) (derived from a metastasis) cells. P33724 transfection The colocalization took place at or near the plasma membrane. cav1-ctnnb1-1 Caveolin-1 and beta-catenin colocalize in MDCK cells 676677 N/A 676685 unspecified role unspecified role neutral component neutral component N/A 676682 unspecified role unspecified role neutral component neutral component physical association physical association false false false 3 A The colocalization took place at or near the plasma membrane. cav1-ctnnb1-2 Caveolin-1 coimmunoprecipitates beta-catenin in HT-29(US) cell lysates 676678 N/A 676681 unspecified role unspecified role prey prey N/A 676682 unspecified role unspecified role bait bait gtpase reaction gtpase reaction false false false 6A, 9 P33724 transfection Beta-catenin coimmunoprecipitated only poorly with caveolin-1 from HT29(US) cells ectopically expressing the protein and did not coimmunoprecipitate E-cadherin. E-cadherin promoted the association of caveolin-1 with beta-catenin cav1-ctnnb1-3 Caveolin-1 coimmunoprecipitates E-cadherin and beta-catenin in DLD1 cell lysates 676679 N/A 676681 unspecified role unspecified role prey prey N/A 676683 unspecified role unspecified role prey prey N/A 676682 unspecified role unspecified role bait bait gtpase reaction gtpase reaction false false false 6 A P33724 transfection cav1-cdh1-1 Caveolin-1 coimmunoprecipitates E-cadherin and beta-catenin in MDCK lysates 676680 N/A 676686 unspecified role unspecified role prey prey N/A 676685 unspecified role unspecified role prey prey N/A 676682 unspecified role unspecified role bait bait association association false false false 6 A