IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yang-2007a-1 Human C-reactive protein binds activating Fcgamma receptors and protects myeloma tumor cells from apoptosis. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang J., Wezeman M., Zhang X., Lin P., Wang M., Qian J., Wan B., Kwak LW., Yu L., Yi Q. Apoptosis - Interactions involving proteins with a function related to apoptosis qyi@mdanderson.org Cancer Cell (1535-6108) 2007 Only protein-protein interactions 3 imex curation Cancer - Interactions investigated in the context of cancer yang-2007a-2 Human C-reactive protein binds activating Fcgamma receptors and protects myeloma tumor cells from apoptosis. human-mm1_144 Homo sapiens myeloma cell line MM1-144 mm1_144 Human myeloma cell line MM1-144 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang J., Wezeman M., Zhang X., Lin P., Wang M., Qian J., Wan B., Kwak LW., Yu L., Yi Q. Apoptosis - Interactions involving proteins with a function related to apoptosis qyi@mdanderson.org Cancer Cell (1535-6108) 2007 Only protein-protein interactions 3 imex curation Cancer - Interactions investigated in the context of cancer crp_human C-reactive protein CRP PTX1 protein protein human Homo sapiens Human MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP fcg2a_human Low affinity immunoglobulin gamma Fc region receptor II-a FCGR2A CD32 FCG2 FCGR2A1 IGFR2 Fc-gamma RII-a CDw32 protein protein human Homo sapiens Human MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN fcg2c_human Low affinity immunoglobulin gamma Fc region receptor II-c FCGR2C CD32 FCG2 IGFR2 Fc-gamma RII-c CDw32 protein protein human Homo sapiens Human MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN fcgr2a-crp FcgammaRIIA coimmunoprecipitates C-reactive protein 666597 N/A 666599 unspecified role unspecified role prey prey N/A 666600 unspecified role unspecified role bait bait human-arp_1 Homo sapiens myeloma cell line ARP-1 arp_1 Human myeloma cell line ARP-1 physical association physical association false false false 4 B fcgr2c-crp-1 FcgammaRIIAC coimmunoprecipitates C-reactive protein 666597 N/A 666599 unspecified role unspecified role prey prey N/A 666601 unspecified role unspecified role bait bait human-arp_1 Homo sapiens myeloma cell line ARP-1 arp_1 Human myeloma cell line ARP-1 physical association physical association false false false 4 B fcgr2c-crp-2 FcgammaRIIAC coimmunoprecipitates C-reactive protein 666598 N/A 666601 unspecified role unspecified role bait bait human-arp_1 Homo sapiens myeloma cell line ARP-1 arp_1 Human myeloma cell line ARP-1 N/A 666599 unspecified role unspecified role prey prey physical association physical association false false false 4 C