IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fuentes-2007-1 RAGE activation by S100P in colon cancer stimulates growth, migration, and cell signaling pathways. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fuentes MK., Nigavekar SS., Arumugam T., Logsdon CD., Schmidt AM., Park JC., Huang EH. Cancer - Interactions investigated in the context of cancer eminah@umich.edu Dis. Colon Rectum (0012-3706) 2007 mok_human MAPK/MAK/MRK overlapping kinase RAGE1 MOK protein kinase Renal tumor antigen 1 MOK RAGE protein protein human Homo sapiens Human MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHRKAGFPEHPVAPEPLSNSCQISKEGRKQKQSLKQEEDRPKRRGPAYVMELPKLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDLKPAPQQCRLPTIVRKGGR s100p_human Protein S100-P S100 calcium-binding protein P S100P S100E Protein S100-E Migration-inducing gene 9 protein protein protein human Homo sapiens Human MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK s100p-rage S100P coimmunoprecipitates RAGE from SW480 lysates 663179 N/A 663180 unspecified role unspecified role prey prey human-colon human colon colon N/A 663181 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false 4 A AmphP - Coincubating the samples with AmphP inhibited the interaction of S100P and RAGE. AmphP is a peptide derived from the RAGE ligand, amphoterin, which functions as a competitive antagonist to RAGE.