IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lopez_berga-2007-1 Rewired ERK-JNK signaling pathways in melanoma. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lopez-Bergami P., Huang C., Goydos JS., Yip D., Bar-Eli M., Herlyn M., Smalley KS., Mahale A., Eroshkin A., Aaronson S., Ronai Z. Cancer - Interactions investigated in the context of cancer Nuclear extracts were incubated with 32P-labeled DNA probe and DNA-protein complexes were separated by electrophoresis and visualized by autoradiography. I used Ensembl to obtain the position of the mouse RACK1 gene on chromosome 11. Then used the sequence for chromosome 11 corresponding to positions -67 to -54 that is 48 643 716 to 48 643 729 to get the AP-1 sequence.>11 dna:chromosome chromosome:NCBIM36:11:48643716:48643729:1 GCAGTGAATCATGG. The authors have confirmed that the cell type used to prepare the nuclear extracts was Lu1205. ronai@burnham.org Cancer Cell (1535-6108) 2007 rack1_mouse_dna AP-1 element at -67 to -54 of RACK1 promoter ds dna double stranded deoxyribonucleic acid ds DNA ds dna in vitro In vitro GCAGTGAATCATGG This is the sequence of one AP-1 element corresponding to the -67 to -54 region of the promoter of RACK1. jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF rack1-jun 608764 N/A 608765 unspecified role unspecified role bait bait N/A 608766 unspecified role unspecified role prey prey human-lu1205 Homo sapiens melanoma cell line lu1205 human melanoma cell line Lu1205 No CABRI identifier. physical association physical association false false false The DNA probe was made by annealing two complementary oligonucleotides corresponding to the region of RACK1 from -67 to -54 with 5 prime overhanging Tresidues which were labeled with [alpha-32P]dATP. 5 C, S13 This interaction does not occur when nuclear extracts from cells treated with c-Jun siRNA are used.