IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ nazarenko-2007-2 Mechanisms of the HRSL3 tumor suppressor function in ovarian carcinoma cells. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nazarenko I., Schafer R., Sers C. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with PR36 and B56 since the exact gene product of interactor cannot be ascertained. christine.sers@charite.de A human kidney cDNA library was used. J. Cell. Sci. (0021-9533) 2007 Only protein-protein interactions imex curation nazarenko-2007-4 Mechanisms of the HRSL3 tumor suppressor function in ovarian carcinoma cells. human-ovcar3 Homo sapiens OVCAR-3 ovarian adenocarcinoma cell line ovcar3 OVCAR3 human ovarian adenocarcinoma cell line Species: human, Caucasian female 60 years old; Tissue: ovary; Tumor: adenocarcinoma; Derived from: ascitic fluid anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nazarenko I., Schafer R., Sers C. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with PR36 and B56 since the exact gene product of interactor cannot be ascertained. christine.sers@charite.de A human kidney cDNA library was used. J. Cell. Sci. (0021-9533) 2007 Only protein-protein interactions imex curation nazarenko-2007-1 Mechanisms of the HRSL3 tumor suppressor function in ovarian carcinoma cells. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nazarenko I., Schafer R., Sers C. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with PR36 and B56 since the exact gene product of interactor cannot be ascertained. christine.sers@charite.de A human kidney cDNA library was used. J. Cell. Sci. (0021-9533) 2007 Only protein-protein interactions imex curation nazarenko-2007-3 Mechanisms of the HRSL3 tumor suppressor function in ovarian carcinoma cells. human-ovcar3 Homo sapiens OVCAR-3 ovarian adenocarcinoma cell line ovcar3 OVCAR3 human ovarian adenocarcinoma cell line Species: human, Caucasian female 60 years old; Tissue: ovary; Tumor: adenocarcinoma; Derived from: ascitic fluid pull down pull down western blot western blot Immuno blot Immuno blot Nazarenko I., Schafer R., Sers C. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with PR36 and B56 since the exact gene product of interactor cannot be ascertained. christine.sers@charite.de A human kidney cDNA library was used. J. Cell. Sci. (0021-9533) 2007 Only protein-protein interactions imex curation nazarenko-2007-5 Mechanisms of the HRSL3 tumor suppressor function in ovarian carcinoma cells. human-ovcar3 Homo sapiens OVCAR-3 ovarian adenocarcinoma cell line ovcar3 OVCAR3 human ovarian adenocarcinoma cell line Species: human, Caucasian female 60 years old; Tissue: ovary; Tumor: adenocarcinoma; Derived from: ascitic fluid confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Nazarenko I., Schafer R., Sers C. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with PR36 and B56 since the exact gene product of interactor cannot be ascertained. christine.sers@charite.de A human kidney cDNA library was used. J. Cell. Sci. (0021-9533) 2007 Only protein-protein interactions imex curation plat3_human Phospholipase A and acyltransferase 3 PLAAT3 Adipose-specific phospholipase A2 Group XVI phospholipase A1/A2 H-rev 107 protein homolog HRAS-like suppressor 1 HRAS-like suppressor 3 HRASLS3 HREV107 HREV107-3 PLA2G16 Renal carcinoma antigen NY-REN-65 protein protein human Homo sapiens Human MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA ppp2r1a-hrasls3 PR65alpha-V5 coimmunoprecipitates HRSL3-HA in COS-7 lysates 599537 N/A 599542 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 599543 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A, D P30153; P53816 transfection hrasls3-ppp2r1a-2 PR65alpha-V5 coimmunoprecipitates with HRSL3-HA in COS-7 lysates 599537 N/A 599542 unspecified role unspecified role bait bait c terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 599543 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A, D P30153; P53816 transfection ppp2r1a-hrasls3-1 HRSL3 coprecipitates with PR65alpha in OVCAR-3 lysate 599538 N/A 599543 unspecified role unspecified role bait bait N/A 599542 unspecified role unspecified role prey prey physical association physical association false false false 2 D P53816 was over-expressed P53816 transfection The proteins B56 and PR36 also coprecipitate with PR65alpha but the antibodies used were not isoform-specific. ppp2r1a-hrasls3-2 HRSL3 and PR65alpha coprecipitate in the same complex in OVCAR-3 lysate 599538 N/A 599543 unspecified role unspecified role bait bait N/A 599542 unspecified role unspecified role prey prey physical association physical association false false false 2 B P53816 was over-expressed P53816 transfection Analysis of the recovered protein complexes revealed the presence of the endogenous regulatory subunit PR65alpha and the overexpressed HRSL3 protein hrasls3-ppp2r1a HRSL3 interacts with the alpha-isoform of the regulatory subunit A of PP2A 599539 N/A 599542 unspecified role unspecified role bait bait N/A 599543 unspecified role unspecified role prey prey physical association physical association false false false hrasls3-ppp2r1a-1 GST-HRSL3 pulls down PR65alpha from OVCAR-3 lysates 599540 N/A 599543 unspecified role unspecified role prey prey N/A 599542 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 1 B hrasls3-ppp2r1a-3 HRSL3-V5 colocalizes with PR65alpha in OVCAR-3 cells 599541 N/A 599543 unspecified role unspecified role neutral component neutral component N/A 599542 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 2 D