IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ma-2007-3 GRIM-19 associates with the serine protease HtrA2 for promoting cell death. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ma X., Kalakonda S., Srinivasula SM., Reddy SP., Platanias LC., Kalvakolanu DV. Parkinsons - Interactions investigated in the context of Parkinsons disease dkalvako@umaryland.edu Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer ma-2007-1 GRIM-19 associates with the serine protease HtrA2 for promoting cell death. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ma X., Kalakonda S., Srinivasula SM., Reddy SP., Platanias LC., Kalvakolanu DV. Parkinsons - Interactions investigated in the context of Parkinsons disease dkalvako@umaryland.edu Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer ma-2007-2 GRIM-19 associates with the serine protease HtrA2 for promoting cell death. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ma X., Kalakonda S., Srinivasula SM., Reddy SP., Platanias LC., Kalvakolanu DV. Parkinsons - Interactions investigated in the context of Parkinsons disease dkalvako@umaryland.edu Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer ma-2007-4 GRIM-19 associates with the serine protease HtrA2 for promoting cell death. human-htert_hme1 Homo sapiens non-oncogenic immortalized mammary epithelial cell line hTERT-HME1 htert_hme1 hTERT-HME1 non-oncogenic immortalized mammary epithelial cell line ATCC Number: CRL-4010 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ma X., Kalakonda S., Srinivasula SM., Reddy SP., Platanias LC., Kalvakolanu DV. Parkinsons - Interactions investigated in the context of Parkinsons disease dkalvako@umaryland.edu Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer ma-2007-5 GRIM-19 associates with the serine protease HtrA2 for promoting cell death. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ma X., Kalakonda S., Srinivasula SM., Reddy SP., Platanias LC., Kalvakolanu DV. Parkinsons - Interactions investigated in the context of Parkinsons disease dkalvako@umaryland.edu Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer htra2_human Serine protease HTRA2, mitochondrial High temperature requirement protein A2 Omi stress-regulated endoprotease Serine proteinase OMI Serine protease 25 HTRA2 PRSS25 OMI protein protein human Homo sapiens Human MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE nduad_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 NDUFA13 CGI-39 CDA016 NADH-ubiquinone oxidoreductase B16.6 subunit Complex I-B16.6 Gene associated with retinoic and interferon-induced mortality 19 protein Cell death regulatory protein GRIM-19 GRIM19 protein protein human Homo sapiens Human MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT ndufa13-htra2-1 Endogenous GRIM-19 coimmunoprecipitates HtrA2 in MCF-7 lysates 657067 N/A 657072 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 657073 unspecified role unspecified role bait bait physical association physical association false false false 1 E IFN-beta/Retinoic acid treatment significantly increased this interaction, although IFN-beta alone also pormoted the interaction. htra2-ndufa13 Endogenous GRIM-19 coimmunoprecipitates with HtrA2 in MCF-7 lysates 657067 N/A 657073 unspecified role unspecified role prey prey N/A 657072 unspecified role unspecified role bait bait physical association physical association false false false 1 G nduf13-htra2 GRIM-19 interacts with HtrA2 in a yeast two-hybrid assay 657068 N/A 657073 unspecified role unspecified role bait bait N/A 657072 unspecified role unspecified role prey prey region PDZ domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false S1 ndufa13-htra2 GRIM-19 coimmunoprecipitates HtrA2 in MCF-7 lysates 657069 N/A 657073 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 657072 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 C Q9P0J0; O43464 transfection htra2-ndufa13-1 Endogenous HtrA2 coimmunoprecipitates GRIM-19 from hTERT-HME1 lysates 657070 N/A 657072 unspecified role unspecified role bait bait N/A 657073 unspecified role unspecified role prey prey physical association physical association false false false S2 A, 7 A IFN-beta/Retinoic acid treatment significantly enhanced this interaction. Human herpes virus-8-coded oncoprotein vIRF1 inhibited the IFN-beta/Retinoic acid-induced HtrA2-GRIM-19 interaction. ndufa13-htra2-2 myc-GRIM-19 coimmunoprecipitates endogenous HtrA2 in MCF-7 lysates 657071 N/A 657073 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 657072 unspecified role unspecified role prey prey physical association physical association false false false Q9P0J0 transfection 3 K IFN-beta/Retinoic acid stimulated GRIM-19's interaction with endogenous HtrA2.