IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ idogawa-2007-1 Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation idogawa-2007-3 Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation idogawa-2007-4 Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation idogawa-2007-2 Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation idogawa-2007-5 Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation idogawa-2007-6 Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation idogawa-2007-7 Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. human-dld1 Human colorectal adenocarcinoma dld1 Human colon adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation xrcc6_human X-ray repair cross-complementing protein 6 XRCC6 G22P1 ATP-dependent DNA helicase II 70 kDa subunit Lupus Ku autoantigen protein p70 70 kDa subunit of Ku antigen Thyroid-lupus autoantigen CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 ATP-dependent DNA helicase 2 subunit 1 5'-deoxyribose-5-phosphate lyase Ku70 protein protein human Homo sapiens Human MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD xrcc5_human X-ray repair cross-complementing protein 5 XRCC5 G22P2 ATP-dependent DNA helicase II 80 kDa subunit Lupus Ku autoantigen protein p86 86 kDa subunit of Ku antigen Ku86 Ku80 Thyroid-lupus autoantigen CTC box-binding factor 85 kDa subunit Nuclear factor IV DNA repair protein XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) ATP-dependent DNA helicase 2 subunit 2 protein protein human Homo sapiens Human MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW tf7l2_human Transcription factor 7-like 2 TCF7L2 TCF4 HMG box transcription factor 4 T-cell-specific transcription factor 4 protein protein human Homo sapiens Human MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL tcf7l2-parp1-1 PARP1, Ku70 and Ku80 coimmunoprecipitate with FLAG-TCF-4 (TCF7L2) in HEK293 cell lysate 592910 N/A 592917 unspecified role unspecified role prey prey N/A 592918 unspecified role unspecified role prey prey N/A 592919 unspecified role unspecified role prey prey N/A 592920 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1 B Q9NQB0 transfection tcf7l2-g22p1 Ku70 coimmunoprecipitates with FLAG-TCF-4 constructs containing HMG box in HEK293 cell lysate 592910 N/A 592917 unspecified role unspecified role prey prey N/A 592920 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 A Q9NQB0 transfection tcf7l2-ctnnb1-7 Ku70 and Beta-catenin coimmunoprecipitate with FLAG-TCF-4 in HEK293 cell lysate 592910 N/A 592917 unspecified role unspecified role prey prey N/A 592921 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 592920 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Q9NQB0; P35222 transfection 4 D Ku70 appears to inhibit participation of beta-catenin in this complex as siRNA against Ku70 increases the amount of beta-catenin in this complex. parp1-tcf7l2-1 TCF-4 (TCF7L2), Ku70 and Ku80 coimmunoprecipitate with PARP1 in HEK293 cell lysate 592911 N/A 592920 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 592918 unspecified role unspecified role prey prey N/A 592917 unspecified role unspecified role prey prey N/A 592919 unspecified role unspecified role bait bait association association false false false 1 C Q9NQB0 transfection g22p1-parp1 TCF-4 (TCF7L2), PARP1 and Ku80 coimmunoprecipitate with Ku70 in HEK293 cell lysate 592911 N/A 592917 unspecified role unspecified role bait bait N/A 592920 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 592918 unspecified role unspecified role prey prey N/A 592919 unspecified role unspecified role prey prey association association false false false 1 C Q9NQB0 transfection tcf7l2-ctnnb1-8 PARP1, Ku70 and Ku80 and beta-catenin coimmunoprecipitate with FLAG-TCF-4 (TCF7L2) in HCT116 nuclear extract 592912 N/A 592921 unspecified role unspecified role prey prey N/A 592919 unspecified role unspecified role prey prey N/A 592917 unspecified role unspecified role prey prey N/A 592918 unspecified role unspecified role prey prey N/A 592920 unspecified role unspecified role bait bait association association false false false 1 D parp1-g22p1 Ku70 and Ku80 coimmunoprecipitate with PARP1 in HCT116 nuclear extract 592912 N/A 592917 unspecified role unspecified role prey prey N/A 592918 unspecified role unspecified role prey prey N/A 592919 unspecified role unspecified role bait bait association association false false false S1 tcf7l2-parp1 PARP1, Ku70 and Ku80 coimmunoprecipitate with FLAG-TCF-4 (TCF7L2) in HEK293 cell lysate 592913 N/A 592917 unspecified role unspecified role prey prey N/A 592918 unspecified role unspecified role prey prey N/A 592920 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 592919 unspecified role unspecified role prey prey association association false false false 1 A Q9NQB0 transfection g22p1-tcf7l2 FLAG-TCF-4 coimmunoprecipitates Myc-Ku70 in HEK293 cell lysate 592914 N/A 592920 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 592917 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 B Q9NQB0; P12956 transfection tcf7l2-g22p1-1 Ku70 coimmunoprecipitates with FLAG-TCF-4 in HEK293 cell lysate in the absence of PARP1 592915 N/A 592917 unspecified role unspecified role prey prey N/A 592920 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Q9NQB0 transfection 4 A, B The amount of Ku70 coimmunoprecipitated with FLAG-TCF-4 was reduced by the presence of PARP1. The results indicate PARP1 and Ku70 compete for binding to TCF-4. tcf7l2-parp1-5 Ku70, Ku80, PARP1 and beta-catenin coimmunoprecipitate with FLAG-TCF-4 (TCF7L2) in HEK293 cell lysate 592916 N/A 592921 unspecified role unspecified role prey prey N/A 592919 unspecified role unspecified role prey prey N/A 592917 unspecified role unspecified role prey prey N/A 592918 unspecified role unspecified role prey prey N/A 592920 unspecified role unspecified role bait bait association association false false false 5 D The amount of Ku70 coimmunoprecipitated was increased by bleomycing treatment (which causes DNA-damaging alkylation).