IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fan-2007-1 Insulin-like growth factor 1/insulin signaling activates androgen signaling through direct interactions of Foxo1 with androgen receptor. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fan W., Yanase T., Morinaga H., Okabe T., Nomura M., Daitoku H., Fukamizu A., Kato S., Takayanagi R., Nawata H. Cancer - Interactions investigated in the context of cancer The LNCaP cells used were transfected with PTEN (human phosphatase and tensin homolog). yanase@intmed3.med.kyushu-u.ac.jp J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation fan-2007-6 Insulin-like growth factor 1/insulin signaling activates androgen signaling through direct interactions of Foxo1 with androgen receptor. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Fan W., Yanase T., Morinaga H., Okabe T., Nomura M., Daitoku H., Fukamizu A., Kato S., Takayanagi R., Nawata H. Cancer - Interactions investigated in the context of cancer The LNCaP cells used were transfected with PTEN (human phosphatase and tensin homolog). yanase@intmed3.med.kyushu-u.ac.jp J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation fan-2007-2 Insulin-like growth factor 1/insulin signaling activates androgen signaling through direct interactions of Foxo1 with androgen receptor. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 1 hybrid one hybrid yeast one-hybrid yeast one hybrid one-hybrid 1 hybrid yeast one-hybrid one-hybrid yeast one hybrid predetermined predetermined participant predetermined Fan W., Yanase T., Morinaga H., Okabe T., Nomura M., Daitoku H., Fukamizu A., Kato S., Takayanagi R., Nawata H. Cancer - Interactions investigated in the context of cancer The LNCaP cells used were transfected with PTEN (human phosphatase and tensin homolog). yanase@intmed3.med.kyushu-u.ac.jp J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation fan-2007-3 Insulin-like growth factor 1/insulin signaling activates androgen signaling through direct interactions of Foxo1 with androgen receptor. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fan W., Yanase T., Morinaga H., Okabe T., Nomura M., Daitoku H., Fukamizu A., Kato S., Takayanagi R., Nawata H. Cancer - Interactions investigated in the context of cancer The LNCaP cells used were transfected with PTEN (human phosphatase and tensin homolog). yanase@intmed3.med.kyushu-u.ac.jp J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation fan-2007-4 Insulin-like growth factor 1/insulin signaling activates androgen signaling through direct interactions of Foxo1 with androgen receptor. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy tag visualisation tag visualisation Fan W., Yanase T., Morinaga H., Okabe T., Nomura M., Daitoku H., Fukamizu A., Kato S., Takayanagi R., Nawata H. Cancer - Interactions investigated in the context of cancer The LNCaP cells used were transfected with PTEN (human phosphatase and tensin homolog). yanase@intmed3.med.kyushu-u.ac.jp J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation fan-2007-5 Insulin-like growth factor 1/insulin signaling activates androgen signaling through direct interactions of Foxo1 with androgen receptor. mouse-3t3_l1 Mus musculus embryonic cells Fibroblast-like. Adipose like when confluent 3t3_l1 Mouse embryo cells Fibroblast-like. Adipose like when confluent confocal microscopy confocal microscopy tag visualisation tag visualisation Fan W., Yanase T., Morinaga H., Okabe T., Nomura M., Daitoku H., Fukamizu A., Kato S., Takayanagi R., Nawata H. Cancer - Interactions investigated in the context of cancer The LNCaP cells used were transfected with PTEN (human phosphatase and tensin homolog). yanase@intmed3.med.kyushu-u.ac.jp J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation foxo1_mouse Forkhead box protein O1 Foxo1 Fkhr Foxo1a Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein mouse Mus musculus Mouse MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ foxo1_human Forkhead box protein O1 FOXO1 FKHR FOXO1A Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein human Homo sapiens Human MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG klk3_human_gene Human kallikrein-related peptidase 3 (KLK3) (PSA) gene gene human Homo sapiens Human andr_mouse Androgen receptor Ar Nr3c4 Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 protein protein mouse Mus musculus Mouse MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREAIQNPGPRHPEAANIAPPGACLQQRQETSPRRRRRQQHTEDGSPQAHIRGPTGYLALEEEQQPSQQQAASEGHPESSCLPEPGAATAPGKGLPQQPPAPPDQDDSAAPSTLSLLGPTFPGLSSCSADIKDILNEAGTMQLLQQQQQQQQHQQQHQQHQQQQEVISEGSSARAREATGAPSSSKDSYLGGNSTISDSAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYASLLGGPPAVRPTPCAPLPECKGLPLDEGPGKSTEETAEYSSFKGGYAKGLEGESLGCSGSSEAGSSGTLEIPSSLSLYKSGALDEAAAYQNRDYYNFPLALSGPPHPPPPTHPHARIKLENPLDYGSAWAAAAAQCRYGDLGSLHGGSVAGPSTGSPPATTSSSWHTLFTAEEGQLYGPGGGGGSSSPSDAGPVAPYGYTRPPQGLTSQESDYSASEVWYPGGVVNRVPYPSPNCVKSEMGPWMENYSGPYGDMRLDSTRDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGENSNAGSPTEDPSQKMTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ ar-foxo1 Androgen receptor coimmunoprecipitates Foxo1 in LNCaP lysates 738882 N/A 738888 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 738889 unspecified role unspecified role bait bait physical association physical association false false false 3 A 5alpha-dihydrotestosterone (DHT) - DHT treatment of cells enhances this interaction. IGF1 or insulin treatment of cells decreased the levels of this interaction but did not abolish it. P10275; Q9R1E0 transfection ar-foxo1-1 Endogenous androgen receptor coimmunoprecipitates endogenous Foxo1 in LNCaP lysates 738882 N/A 738890 unspecified role unspecified role prey prey N/A 738889 unspecified role unspecified role bait bait physical association physical association false false false S 5 5alpha-dihydrotestosterone (DHT) - DHT treatment of cells enhances this interaction. foxo1-klk3 Foxo1 binds the KLK3 (PSA) promoter in a ChIP assay 738883 N/A 738888 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 738891 unspecified role unspecified role prey prey association association false false false 5b Occupancy of the promoter and enhancer regions of the PSA gene was increased by DHT (5alpha-dihydrotestosterone). Occupancy of the promoter and enhancer regions of the PSA gene was decreased by treatment with IGF1 or insulin. Q9R1E0 transfection ar-klk3 Androgen receptor binds the KLK3 (PSA) promoter in a ChIP assay 738883 N/A 738889 unspecified role unspecified role bait bait N/A 738891 unspecified role unspecified role prey prey association association false false false 5 C Foxo1-3A (T24A, S253A, S316A), an AKT non-phosphorylable mutant, singificantly interfered with the increase of AR bound to KLK3 (PSA). This suggests that phosphorylable Foxo1 is required for the increase in AR-DNA interaction in response to IGF1 or insulin. ar-foxo1-2 Androgen receptor and Foxo1 interact in a mammalian one-hybrid assay 738884 N/A 738888 unspecified role unspecified role prey prey N/A 738889 unspecified role unspecified role bait bait physical association physical association false false false 3 B This interaction is inhibited by the presence of FLAG-Foxo1. 5alpha-dihydrotestosterone (DHT) - This interaction was enhanced by treatment of cells with DHT. Insulin - This interaction was enhanced by treatment of cells with insulin. ar-foxo1-3 Androgen receptor and Foxo1 interact in a mammalian two-hybrid assay 738885 N/A 738888 unspecified role unspecified role prey prey N/A 738889 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Foxo1 cDNA was fused to the VP16 activation domain in either the forward (pACT-Foxo1-F) or reverse orientation (pACT-Foxo1-R); pACT-Foxo1-F, but not pACT-Foxo1-R significantly stimulated the reporter in the presence of DHT. 3 D 5alpha-dihydrotestosterone (DHT) - This interaction was enhanced by treatment of cells with DHT. ar-foxo1-4 Androgen receptor and Foxo1 colocalize in COS-7 cells 738886 N/A 738888 unspecified role unspecified role neutral component neutral component region EYFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 738889 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 4, S8 This colocalization was inhibited when cells treated with DHT (5alpha-dihydrotestosterone ) were also treated with IGF1. P10275; Q9R1E0 transfection EYFP-Foxo1-3A (T24A, S253A, and S316A), an AKT non-phosphorylable mutant, is localized in the nucleus in a manner not dependent on IGF1 treatment. EYFP-Foxo1-3A disrupted formation of DHT (5alpha-dihydrotestosterone) induced AR foci and this could not be recued by IGF1 treatment. ar-foxo1-5 Endogenous androgen receptor and Foxo1 colocalize in 3T3-L1 cells 738887 N/A 738888 unspecified role unspecified role neutral component neutral component region EYFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 738892 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false S 7 Q9R1E0 transfection Q9R1E0 overexpression AR foci induced by DHT (5alpha-dihydrotestosterone) treatment were reduced by Foxo1 overexpression.