IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xing-2006-1 Structure of protein phosphatase 2A core enzyme bound to tumor-inducing toxins. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xing Y., Xu Y., Chen Y., Jeffrey PD., Chao Y., Lin Z., Li Z., Strack S., Stock JB., Shi Y. Cancer - Interactions investigated in the context of cancer ygshi@princeton.edu Cell (0092-8674) 2006 Only protein-protein interactions 2 imex curation xing-2006-2 Structure of protein phosphatase 2A core enzyme bound to tumor-inducing toxins. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xing Y., Xu Y., Chen Y., Jeffrey PD., Chao Y., Lin Z., Li Z., Strack S., Stock JB., Shi Y. Cancer - Interactions investigated in the context of cancer The PP2A core enzyme was methylated by LCMT in the presence of S-adenosyl methionine. The fully methylated or unmethylated PP2A core enzyme was incubated with an excess amount of the B"/PR72 protein and the mixtures were examined by gel filtration chromatography. ygshi@princeton.edu Cell (0092-8674) 2006 Only protein-protein interactions 2 imex curation okadaic acid Okadaic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA microcystin-peptide Microcystin-LR (MCLR) heptapeptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DRXAAAL An amino acid sequence which is not represented in UniProt This peptide is a tumour inducer. It is an inhibitor of the PP2A phosphatase. p2r3a_human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha PPP2R3A PPP2R3 Serine/threonine-protein phosphatase 2A 72/130 kDa regulatory subunit B PP2A subunit B isoforms B''-PR72/PR130 PP2A subunit B isoforms B72/B130 PP2A subunit B isoform PR72/PR130 PP2A subunit B isoform R3 isoform protein protein human Homo sapiens Human MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPVSQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFASGKIKEFSFEKLKNSNHAAYRKGRKVKSDSFNRRSVDLDLLCGHYNNDGNAPSFGLLRSSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLASYLKKLPFEFMQSGNNEALDLTELISNMPSLQLTPFSPVFGTEQPPKYEDVVQLSASDSGRFQTIELQNDKPNSRKMDTVQSIPNNSTNSLYNLEVNDPRTLKAVQVQSQSLTMNPLENVSSDDLMETLYIEEESDGKKALDKGQKTENGPSHELLKVNEHRAEFPEHATHLKKCPTPMQNEIGKIFEKSFVNLPKEDCKSKVSKFEEGDQRDFTNSSSQEEIDKLLMDLESFSQKMETSLREPLAKGKNSNFLNSHSQLTGQTLVDLEPKSKVSSPIEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIEDFAQELVECKSSRGSLSQEKEMMQILQETLTTSSQANLSVCRSPVGDKAKDTTSAVLIQQTPEVIKIQNKPEKKPGTPLPPPATSPSSPRPLSPVPHVNNVVNAPLSINIPRFYFPEGLPDTCSNHEQTLSRIETAFMDIEEQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGFVTAQSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE ppp2ca-ppp2r1a-1 X-ray Structure of Protein Phosphatase 2A Core Enzyme Bound to Okadaic Acid 569866 N/A 569868 unspecified role unspecified role neutral component neutral component N/A 569869 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ile71 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg70 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false glu67 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false lys74 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp280 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp280 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg70 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp280 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asn79 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pro76 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp77 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pro51 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 1.0 N/A 569870 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false leu454 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg417 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg417 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tyr455 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pro492 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trp416 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tyr494 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp530 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp491 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pro492 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asn534 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asn534 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asn534 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false val532 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 1.0 569891 569877 569892 569878 569894 569880 569895 569884 569896 569883 569897 569881 569898 569882 569899 569900 569901 569902 569903 569904 569905 569885 569906 569886 569907 569887 569908 569888 direct interaction direct interaction false false false Table 1, Figure 3, Figure 4 2.5 A Rwork 0.226; Rfree 0.270 The regulatory subunit sequence used in the experiment had an initial Met whereas the UniprotKB sequence does not. The regulatory subunit sequence used has an initial Met and an Arg at position 259, whereas the sequence for P30153 has no initial Met and an Ala at position 258. ppp2ca-ppp2r1a-2 X-ray Structure of Protein Phosphatase 2A Core Enzyme Bound to Microcystin-LR 569866 N/A 569871 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 N/A 569869 unspecified role unspecified role neutral component neutral component arg70 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp280 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp280 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg70 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ile71 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false glu67 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false lys74 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp280 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asn79 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pro76 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp77 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pro51 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 1.0 N/A 569870 unspecified role unspecified role neutral component neutral component arg417 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pro492 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asn534 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asn534 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trp416 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false leu454 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg417 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tyr455 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pro492 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tyr494 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp530 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arg497 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asp491 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false asn534 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false val532 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 1.0 569926 569912 569927 569942 569928 569929 569930 569921 569931 569922 569933 569915 569934 569916 569935 569917 569936 569918 569937 569919 569938 569913 569939 569914 569940 569941 569943 569920 569944 569923 direct interaction direct interaction false false false Table 1, 3, 4 The regulatory subunit sequence used has an initial Met and an Arg at position 259, whereas the sequence for P30153 has no initial Met and an Ala at position 258. The catalytic subunit sequence used has an Val at position 5 whereas the sequence for P67775 has a Leu at position 5. Microcystin-LR is an inhibitor of PP2A and is an tumour-inducing agent. 2.8 A Rwork 0.222; Rfree 0.264 ppp2ca-ppp2r1a 569867 N/A 569872 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 569869 unspecified role unspecified role neutral component neutral component leu309 meres methylated residue MeRes Methylation (N terminus, N epsilon of Lysine, O of Serine, Threonine or C terminus, N of Asparagine) certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 569870 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 6 The interaction of the core PP2A enzyme (P67775 and P30153) with PR72 (Q06190) requires the methylated of Leu-309 of the catalytic subunit of the core enzyme.