MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kisseleva_r-2006-1 Yeast homolog of a cancer-testis antigen defines a new transcription complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap fingerprinting peptide massfingerprinting fingerprinting Kisseleva-Romanova E., Lopreiato R., Baudin-Baillieu A., Rousselle JC., Ilan L., Hofmann K., Namane A., Mann C., Libri D. Cancer - Interactions investigated in the context of cancer libri@cgm.cnrs-gif.fr EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation kisseleva_r-2006-2 Yeast homolog of a cancer-testis antigen defines a new transcription complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Kisseleva-Romanova E., Lopreiato R., Baudin-Baillieu A., Rousselle JC., Ilan L., Hofmann K., Namane A., Mann C., Libri D. Cancer - Interactions investigated in the context of cancer Gel filtration analysis was performed on a Superdex 200 column. libri@cgm.cnrs-gif.fr EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation kisseleva_r-2006-3 Yeast homolog of a cancer-testis antigen defines a new transcription complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column sequence tag sequence tag identification sequence tag Kisseleva-Romanova E., Lopreiato R., Baudin-Baillieu A., Rousselle JC., Ilan L., Hofmann K., Namane A., Mann C., Libri D. Cancer - Interactions investigated in the context of cancer The Pcc2-TAP complex was bound to IgG-Sepharose and eluted by cleavage with the TEV protease. The eluate was subjected to Superdex 200 gel filtration and the proteins in individual fractions were visualized by Coomassie blue staining after SDS-PAGE. The identity of the bands was confirmed by mass spectrometry. libri@cgm.cnrs-gif.fr EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation pcc1_yeast EKC/KEOPS complex subunit PCC1 PCC1 Polarized growth chromatin-associated controller 1 YKR095W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGVSSIIDSIKTIVEAMDVLS cg121_yeast EKC/KEOPS complex subunit CGI121 CGI121 CGI-121 homolog YML036W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVVSIIPQFPDIKVSLALFEQVKNAKEIRSKMSELSTSFAFIDPRLVCSGEQMYSAIYKTLIEVKYNKMRTRNLNSECVLCLSPTSNISDAFLKFGIKDDSSQLICLKFHTNTDDVDKEQLRTIMTSIVKGQEIEFNDDNLSRFYDEALIRKIYKLSDDFKPQDVNGLSRALVDAIQLRGV B0B697F8AB578ED4 gon7_yeast EKC/KEOPS complex subunit GON7 Low-dye-binding protein 6 Polarized growth chromatin-associated controller 2 YJL184W J0420 GON7 LDB6 PCC2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKLPVAQYSAPDGVEKSFAPIRDDPRYMTTEGRTTGPSDHVLNAGQIDRDKPSEPERTKDGSQLTYLGQLRTQLTGLQDDINEFLTGRMELAKNKKKAGADEKRIQEEINQLLDGGDGDEDAV bud32_yeast EKC/KEOPS complex subunit BUD32 YGR262C BUD32 LDB14 piD261 Low-dye-binding protein 14 Atypical serine/threonine protein kinase BUD32 Bud site selection protein 32 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTQEFIDKVSSYLTPDVDIAPISQGAEAIVFTTTTHPYLPRAKDSHQKYIIKYRPPKRYRHPQIDQALTKHRTLNESRLLAKLYLIPGLCVPQLIACDPYNGFIWLEFLGEDLPGGHGFSNLKNFLWMHDQDPYSDLVATTLRKVGRQIGLLHWNDYCHGDLTSSNIVLVRDGARWTPHLIDFGLGSVSNLVEDKGVDLYVLERAILSTHSKHAEKYNAWIMEGFEEVYREQGAKGAKKLKEVTKRFEEVRLRGRKRSMLG D12E97BAE21B3385 kae1_yeast tRNA N6-adenosine threonylcarbamoyltransferase KAE1 t(6)A37 threonylcarbamoyladenosine biosynthesis protein KAE1 Kinase-associated endopeptidase 1 tRNA threonylcarbamoyladenosine biosynthesis protein KAE1 YKR038C N6-L-threonylcarbamoyladenine synthase protein protein yeast Saccharomyces cerevisiae Baker's yeast MVNLNTIPPKNGRDYYIALGLEGSANKLGVGIVKHPLLPKHANSDLSYDCEAEMLSNIRDTYVTPPGEGFLPRDTARHHRNWCIRLIKQALAEADIKSPTLDIDVICFTKGPGMGAPLHSVVIAARTCSLLWDVPLVGVNHCIGHIEMGREITKAQNPVVLYVSGGNTQVIAYSEKRYRIFGETLDIAIGNCLDRFARTLKIPNEPSPGYNIEQLAKKAPHKENLVELPYTVKGMDLSMSGILASIDLLAKDLFKGNKKNKILFDKTTGEQKVTVEDLCYSLQENLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQEMMAQMCKDRANGQVHATDNRFCIDNGVMIAQAGLLEYRMGGIVKDFSETVVTQKFRTDEVYAAWRD 76A73F2E9E26CF4C pcc1-bud32 505058 N/A 505061 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 505062 unspecified role unspecified role prey prey N/A 505063 unspecified role unspecified role prey prey N/A 505064 unspecified role unspecified role prey prey N/A 505065 unspecified role unspecified role prey prey association association false false false Fig. 4C ekc-complex-1 505058 N/A 505061 unspecified role unspecified role prey prey N/A 505063 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 505064 unspecified role unspecified role prey prey N/A 505065 unspecified role unspecified role prey prey association association false false false Fig. 4A bud32-cgi121-1 505059 N/A 505061 unspecified role unspecified role neutral component neutral component region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 505063 unspecified role unspecified role neutral component neutral component region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 505065 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4B bud32-kae1-3 505059 n/a 505065 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 505064 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4B ekc-complex-3 505060 N/A 505061 unspecified role unspecified role neutral component neutral component N/A 505063 unspecified role unspecified role neutral component neutral component region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 505062 unspecified role unspecified role neutral component neutral component N/A 505064 unspecified role unspecified role neutral component neutral component N/A 505065 unspecified role unspecified role neutral component neutral component association association false false false Fig. 4C