IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ godde-2006-2 Efficient ADAM22 surface expression is mediated by phosphorylation-dependent interaction with 14-3-3 protein family members. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Godde NJ., D'Abaco GM., Paradiso L., Novak U. Synapse - Interactions of proteins with an established role in the presynapse. u.novak@unimelb.edu.au Human brain cDNA J. Cell. Sci. (0021-9533) 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer godde-2006-3 Efficient ADAM22 surface expression is mediated by phosphorylation-dependent interaction with 14-3-3 protein family members. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Godde NJ., D'Abaco GM., Paradiso L., Novak U. Synapse - Interactions of proteins with an established role in the presynapse. The source of proteins 14-3-3 zeta, gamma and tau were taken from PMIDs 7615088, 12507503 and 10840038, respectively. u.novak@unimelb.edu.au Human brain cDNA J. Cell. Sci. (0021-9533) 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer godde-2006-1 Efficient ADAM22 surface expression is mediated by phosphorylation-dependent interaction with 14-3-3 protein family members. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Godde NJ., D'Abaco GM., Paradiso L., Novak U. Synapse - Interactions of proteins with an established role in the presynapse. u.novak@unimelb.edu.au Human brain cDNA J. Cell. Sci. (0021-9533) 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer godde-2006-4 Efficient ADAM22 surface expression is mediated by phosphorylation-dependent interaction with 14-3-3 protein family members. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Godde NJ., D'Abaco GM., Paradiso L., Novak U. Synapse - Interactions of proteins with an established role in the presynapse. u.novak@unimelb.edu.au Human brain cDNA J. Cell. Sci. (0021-9533) 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer q9p0k1-1 Disintegrin and metalloproteinase domain-containing protein 22 ADAM22 MDC2 Metalloproteinase-disintegrin ADAM22-3 Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2 Epsilon protein protein human Homo sapiens Human MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDALDTRVRGDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHIEHGGKTVEVKGGEHCYYQGHIRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLPQGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN q9p0k1-3 Disintegrin and metalloproteinase domain-containing protein 22 ADAM22 MDC2 Metalloproteinase-disintegrin ADAM22-3 Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2 Alpha protein protein human Homo sapiens Human MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDALDTRVRGDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHIEHGGKTVEVKGGEHCYYQGHIRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLPQGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTE 1433g_mouse 14-3-3 protein gamma Ywhag protein protein mouse Mus musculus Mouse MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ adam22-ywhaz-1 ADAM22 v1 cytoplasmic domain interacts with 14-3-3 zeta in a directed yeast two-hybrid assay 595409 N/A 595413 unspecified role unspecified role bait bait c-teminal cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9P0K1-1:p.[Arg831Gln;Ser832Gly;Arg854Gln;Ser855Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 595414 unspecified role unspecified role prey prey physical association physical association false false false 2, 4 C adam22-ywhab-1 ADAM22 v1 cytoplasmic domain interacts with 14-3-3 beta in a directed yeast two-hybrid assay 595409 N/A 595415 unspecified role unspecified role prey prey N/A 595413 unspecified role unspecified role bait bait Q9P0K1-1:p.[Arg831Gln;Ser832Gly;Arg854Gln;Ser855Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c-teminal cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2, 4 C adam22-ywhaq-1 ADAM22 v1 cytoplasmic domain interacts with 14-3-3 tau in a directed yeast two-hybrid assay 595409 N/A 595416 unspecified role unspecified role prey prey N/A 595413 unspecified role unspecified role bait bait Q9P0K1-1:p.[Arg831Gln;Ser832Gly;Arg854Gln;Ser855Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c-teminal cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2, 4 C adam22-ywhaq-2 ADAM22 v4 cytoplasmic domain interacts with 14-3-3 tau in a directed yeast two-hybrid assay 595409 N/A 595416 unspecified role unspecified role prey prey N/A 595417 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 adam22-ywhaz-2 ADAM22 v4 cytoplasmic domain interacts with 14-3-3 zeta in a directed yeast two-hybrid assay 595409 N/A 595414 unspecified role unspecified role prey prey N/A 595417 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 adam22-ywhab-2 ADAM22 v4 cytoplasmic domain interacts with 14-3-3 beta in a directed yeast two-hybrid assay 595409 N/A 595417 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 595415 unspecified role unspecified role prey prey physical association physical association false false false 2, 4 C ywhab-adam22 FLAG-ADAM22 v4 coimmunoprecipitates with myc-14-3-3 beta in 293T lysates 595410 N/A 595417 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9P0K1-3:p.[Arg854Gln;Ser855Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9P0K1-3:p.[Arg831Gln;Ser832Gly] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9P0K1-3:p.[Arg831Gln;Ser832Gly;Arg854Gln;Ser855Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c-terminal required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 595415 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3, 4 A, 5 A Q9P0K1-3; P31946 transfection Dephosphorylation of ADAM22 significantly reduced binding of all 14-3-3 isoforms. By contrast, dephosphorylation of 14-3-3 proteins alone did not impact on their ability to co-immunoprecipitate ADAM22. ywhag-adam22 FLAG-ADAM22 v4 coimmunoprecipitates with myc-14-3-3 gamma in 293T lysates 595410 N/A 595417 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 595418 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3, 5 A Q9P0K1-3; P61982 transfection Dephosphorylation of ADAM22 significantly reduced binding of all 14-3-3 isoforms. By contrast, dephosphorylation of 14-3-3 proteins alone did not impact on their ability to co-immunoprecipitate ADAM22. ywhaf-adam22 FLAG-ADAM22 v4 coimmunoprecipitates with myc-14-3-3 eta in 293T lysates 595410 N/A 595417 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 595419 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3, 5 A Q9P0K1-3; Q04917 transfection Dephosphorylation of ADAM22 significantly reduced binding of all 14-3-3 isoforms. By contrast, dephosphorylation of 14-3-3 proteins alone did not impact on their ability to co-immunoprecipitate ADAM22. ywhae-adam22 FLAG-ADAM22 v4 coimmunoprecipitates with myc-14-3-3 epsilon in 293T lysates 595410 N/A 595417 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 595420 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3, 5 A Q9P0K1-3; P62258 transfection Dephosphorylation of ADAM22 significantly reduced binding of all 14-3-3 isoforms. By contrast, dephosphorylation of 14-3-3 proteins alone did not impact on their ability to co-immunoprecipitate ADAM22. ywhaq-adam22 FLAG-ADAM22 v4 coimmunoprecipitates with HA-14-3-3 tau in 293T lysates 595410 N/A 595416 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 595417 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3, 5 A Q9P0K1-3; P27348 transfection Dephosphorylation of ADAM22 significantly reduced binding of all 14-3-3 isoforms. By contrast, dephosphorylation of 14-3-3 proteins alone did not impact on their ability to co-immunoprecipitate ADAM22. ywhaz-adam22 FLAG-ADAM22 v4 coimmunoprecipitates with myc-14-3-3 zeta in 293T lysates 595410 N/A 595417 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 595414 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3, 5 A Q9P0K1-3; P63104 transfection Dephosphorylation of ADAM22 significantly reduced binding of all 14-3-3 isoforms. By contrast, dephosphorylation of 14-3-3 proteins alone did not impact on their ability to co-immunoprecipitate ADAM22. adam22-ywhab ADAM22 v1 cytoplasmic domain interacts with 14-3-3 beta in a yeast two-hybrid assay 595411 N/A 595415 unspecified role unspecified role prey prey N/A 595413 unspecified role unspecified role bait bait c-teminal cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false adam22-ywhaz ADAM22 v1 cytoplasmic domain interacts with 14-3-3 zeta in a yeast two-hybrid assay 595411 N/A 595413 unspecified role unspecified role bait bait c-teminal cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 595414 unspecified role unspecified role prey prey physical association physical association false false false adam22-ywhaq ADAM22 v1 cytoplasmic domain interacts with 14-3-3 tau in a yeast two-hybrid assay 595411 N/A 595413 unspecified role unspecified role bait bait c-teminal cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 595416 unspecified role unspecified role prey prey physical association physical association false false false ywhaz-adam22-1 GST-14-3-3 zeta pulls ADAM22 v4 from 293T lysates 595412 N/A 595417 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9P0K1-3:p.[Arg831Gln;Ser832Gly;Arg854Gln;Ser855Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9P0K1-3:p.[Arg831Gln;Ser832Gly] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 595414 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 4 B