IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yin-2006-5 In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. human-prostate_carcinoma Homo sapiens prostate carcinoma prostate_carcinoma Prostate carcinoma (cancer) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation yin-2006-1 In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation yin-2006-2 In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation yin-2006-3 In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation yin-2006-4 In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation cebpa_human CCAAT/enhancer-binding protein alpha CEBPA CEBP protein protein human Homo sapiens Human MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA xrcc6_human X-ray repair cross-complementing protein 6 XRCC6 G22P1 ATP-dependent DNA helicase II 70 kDa subunit Lupus Ku autoantigen protein p70 70 kDa subunit of Ku antigen Thyroid-lupus autoantigen CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 ATP-dependent DNA helicase 2 subunit 1 5'-deoxyribose-5-phosphate lyase Ku70 protein protein human Homo sapiens Human MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD xrcc5_human X-ray repair cross-complementing protein 5 XRCC5 G22P2 ATP-dependent DNA helicase II 80 kDa subunit Lupus Ku autoantigen protein p86 86 kDa subunit of Ku antigen Ku86 Ku80 Thyroid-lupus autoantigen CTC box-binding factor 85 kDa subunit Nuclear factor IV DNA repair protein XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) ATP-dependent DNA helicase 2 subunit 2 protein protein human Homo sapiens Human MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW cebpa_rat CCAAT/enhancer-binding protein alpha Cebpa protein protein rat Rattus norvegicus (Rat) Rat MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAAGLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA cebpa-g22p1-6 Endogenous C/EBPalpha coimmunoprecipitates Ku70 and Ku80 in human prostate cancer tissue protein extracts 608622 N/A 608627 unspecified role unspecified role bait bait N/A 608628 unspecified role unspecified role prey prey N/A 608629 unspecified role unspecified role prey prey association association false false false 2 F These interactions were detected in all three samples. cebpa-parp1-1 Endogenous C/EBPalpha coimmunoprecipitates PARP-1 in human prostate cancer tissue protein extracts 608622 N/A 608630 unspecified role unspecified role prey prey N/A 608627 unspecified role unspecified role bait bait physical association physical association false false false 2 F The C/EBPalpha interaction with PARP-1 was detected in two of the three samples but not in the third, where PARP-1 was detected only in small fragments. cebpa-g22p1-1 Exogenous C/EBPalpha coimmunoprecipitates Ku70, Ku80 and PARP-1 from Du145 lysates 608623 N/A 608629 unspecified role unspecified role prey prey N/A 608630 unspecified role unspecified role prey prey N/A 608628 unspecified role unspecified role prey prey N/A 608631 unspecified role unspecified role bait bait association association false false false 2 E P05554 transduction P05554 over-expressed cebpa-g22p1-2 Exogenous C/EBPalpha coimmunoprecipitates Ku70, Ku80 and PARP-1 from LNCaP lysate 608624 N/A 608629 unspecified role unspecified role prey prey N/A 608628 unspecified role unspecified role prey prey N/A 608631 unspecified role unspecified role bait bait N/A 608630 unspecified role unspecified role prey prey association association false false false 2 E P05554 transduction P05554 over-expressed cebpa-g22p1-3 Exogenous C/EBPalpha coimmunoprecipitates Ku70, Ku80 and PARP-1 from PC3 lysate 608625 N/A 608628 unspecified role unspecified role prey prey N/A 608630 unspecified role unspecified role prey prey N/A 608629 unspecified role unspecified role prey prey N/A 608631 unspecified role unspecified role bait bait association association false false false 2 E P05554 transduction P05554 over-expressed Among the three transduced cell lines PC3 showed the weakest interaction of C/EBPalpha with Ku proteins and PARP-1. After incubation of the PC3 cells with bleomycin (50 or 100 milliunits/ml) and iron (2.5 E-6 M ferric chloride and 2.5 E-6 M ferrous sulphate) for 24 h, the amount of Ku70, Ku80, and PARP-1 that co-precipitated with C/EBPalpha increased by 6.6, 2.7, and 1.7-fold, respectively. Induction of double-strand DNA breaks (e.g., by treatment with bleomycin and iron) strengthens these interactions. cebpa-g22p1-5 Endogenous C/EBPalpha coimmunoprecipitates Ku70, Ku80 and PARP-1 in LNCaP lysate 608626 N/A 608629 unspecified role unspecified role prey prey N/A 608627 unspecified role unspecified role bait bait N/A 608628 unspecified role unspecified role prey prey N/A 608630 unspecified role unspecified role prey prey association association false false false 2 F