IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ horn-2005a-2 The uncovering of a novel regulatory mechanism for PLD2: formation of a ternary complex with protein tyrosine phosphatase PTP1B and growth factor receptor-bound protein GRB2. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horn J., Lopez I., Miller MW., Gomez-Cambronero J. Cancer - Interactions investigated in the context of cancer COS-7 cells stably transfected with and over-expressing human myc-PLD2 were used. julian.cambronero@wright.edu Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation The PTP1B is stated to be from Calbiochem. The Calbiochem site describes the recombinant PTP1B as human (Cat. No. 539735) and expressed in E. coli. horn-2005a-3 The uncovering of a novel regulatory mechanism for PLD2: formation of a ternary complex with protein tyrosine phosphatase PTP1B and growth factor receptor-bound protein GRB2. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Horn J., Lopez I., Miller MW., Gomez-Cambronero J. Cancer - Interactions investigated in the context of cancer COS-7 cells stably transfected with and over-expressing human myc-PLD2 were used. julian.cambronero@wright.edu Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation The PTP1B is stated to be from Calbiochem. The Calbiochem site describes the recombinant PTP1B as human (Cat. No. 539735) and expressed in E. coli. horn-2005a-1 The uncovering of a novel regulatory mechanism for PLD2: formation of a ternary complex with protein tyrosine phosphatase PTP1B and growth factor receptor-bound protein GRB2. in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Horn J., Lopez I., Miller MW., Gomez-Cambronero J. Cancer - Interactions investigated in the context of cancer COS-7 cells stably transfected with and over-expressing human myc-PLD2 were used. The PTP1B is stated to be from Calbiochem. The Calbiochem site describes the recombinant PTP1B as human (Cat. No. 539735) and expressed in E. coli. julian.cambronero@wright.edu Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation pld2_human Phospholipase D2 Choline phosphatase 2 Phosphatidylcholine-hydrolyzing phospholipase D2 PLD1C PLD2 protein protein human Homo sapiens Human MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGNREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQARWWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIFITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRALMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPWRDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQCTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVDRILKAHKQGWCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILGANTRPDLDLRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT grb2_cerae_protein Cercopithecus aethiops Grb2 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to P62993 ptpn1_cerae_protein Cercopithecus aethiops PTP1B protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to P18031 4-nitrophenyl dihydrogen phosphate 4-nitrophenyl dihydrogen phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT grb2-pld2 Grb2 coimmunoprecipitates myc-PLD2 in COS-7 lysates 651324 N/A 651327 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 651328 unspecified role unspecified role bait bait physical association physical association false false false 8 A O14939 transfection O14939 over-expressed Grb2 - addition of recombinant Grb2 to the lysates prior to immunoprecipitation stimulated the interaction. grb2-ptpn1 Grb2 coimmunoprecipitates PTP1B in COS-7 lysates 651324 N/A 651329 unspecified role unspecified role prey prey N/A 651328 unspecified role unspecified role bait bait physical association physical association false false false 9 A PTP1B - addition of recombinant PTP1B to the lysates prior to immunoprecipitation stimulated the interaction. ptpn1-pld2 PTP1B coimmunoprecipitates myc-PLD2 in COS-7 lysates 651324 N/A 651327 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 651329 unspecified role unspecified role bait bait physical association physical association false false false 9 B PTP1B - addition of recombinant PTP1B to the lysates prior to immunoprecipitation stimulated the interaction. O14939 transfection O14939 over-expressed pld2-grb2 Grb2 coimmunoprecipitates with myc-PLD2 in COS-7 lysates 651325 N/A 651328 unspecified role unspecified role prey prey N/A 651327 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 8 B O14939 transfection O14939 over-expressed Grb2 - addition of recombinant Grb2 to the lysates prior to immunoprecipitation stimulated the interaction. pld2-ptp1b PTP1B coimmunoprecipitates with myc-PLD2 in COS-7 lysates 651325 N/A 651327 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 651329 unspecified role unspecified role prey prey physical association physical association false false false 9 B PTP1B - addition of recombinant PTP1B to the lysates prior to immunoprecipitation stimulated the interaction. O14939 transfection O14939 over-expressed ptpn1-c6h6no6p PTP1B dephosphorylates PNPP in vitro 651326 N/A 651330 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 651331 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation false false false 4 DTT - the presence of DTT (2.0 E-4 M or 5.0 E-4 M) stimulates the phosphatase activity of PTP1B. EDTA - the presence of EDTA (1.0 E-3 M or 2.0 E-3 M) stimulates the phosphatase activity of PTP1B. ZnCl2 - the presence of ZnCl2 (5.0 E-2 M or 1.0 E-1 M) inhibits the phosphatase activity of PTP1B.