IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ takami-2005-2 Human homologue of maid is a useful marker protein in hepatocarcinogenesis. human-kmc_1 Homo sapiens cholangiocellular (bile duct) carcinoma cell line kmc_1 cholangiocellular (bile duct) carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp Gastroenterology (0016-5085) 2005 Only protein-protein interactions imex curation A human bone marrow cDNA library (Clontech) was used. takami-2005-1 Human homologue of maid is a useful marker protein in hepatocarcinogenesis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp A human bone marrow cDNA library (Clontech) was used. Gastroenterology (0016-5085) 2005 Only protein-protein interactions imex curation takami-2005-3 Human homologue of maid is a useful marker protein in hepatocarcinogenesis. human-kmc_1 Homo sapiens cholangiocellular (bile duct) carcinoma cell line kmc_1 cholangiocellular (bile duct) carcinoma cell line confocal microscopy confocal microscopy immunostaining immunostaining Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp Gastroenterology (0016-5085) 2005 Only protein-protein interactions imex curation A human bone marrow cDNA library (Clontech) was used. takami-2005-4 Human homologue of maid is a useful marker protein in hepatocarcinogenesis. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy immunostaining immunostaining Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp Gastroenterology (0016-5085) 2005 Only protein-protein interactions imex curation A human bone marrow cDNA library (Clontech) was used. csn5_human COP9 signalosome complex subunit 5 Jun activation domain-binding protein 1 COPS5 CSN5 JAB1 protein protein human Homo sapiens Human MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS ccdb1_human Cyclin-D1-binding protein 1 Grap2 and cyclin-D-interacting protein Human homolog of Maid CCNDBP1 DIP1 GCIP HHM protein protein human Homo sapiens Human MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAAVTVSREATTLTIVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRGATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQELIIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL ccndbp1-cops5-1 HHM coimmunoprecipitates Jab1 from KMC-1 nuclear extracts 662089 N/A 662093 unspecified role unspecified role prey prey N/A 662094 unspecified role unspecified role bait bait physical association physical association false false false 5A ccndbp1-cops5-5 JAB1 coimmunoprecipitates HMM from KMC-1 nuclear extracts 662089 N/A 662093 unspecified role unspecified role bait bait N/A 662094 unspecified role unspecified role prey prey physical association physical association false false false 5B ccndbp1-cops5 HHM interacts with Jab1 in a yeast two-hybrid assay 662090 N/A 662093 unspecified role unspecified role prey prey N/A 662094 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ccndbp1-cops5-2 HHM colocalizes with Jab1 in KMC-1 cells 662091 N/A 662093 unspecified role unspecified role neutral component neutral component N/A 662094 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6 D ccndbp1-cops5-3 HHM colocalizes with Jab1 in HepG2 nuclear extracts 662092 N/A 662094 unspecified role unspecified role neutral component neutral component N/A 662093 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6 H