IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ de_wit-2004-3 Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl The library pJG-HeLa (HeLa cell line) was used. Eur. J. Cell Biol. (0171-9335) 2004 Only protein-protein interactions imex curation de_wit-2004-1 Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl The library pJG-HeLa (HeLa cell line) was used. Eur. J. Cell Biol. (0171-9335) 2004 Only protein-protein interactions imex curation de_wit-2004-2 Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl The library pJG-HeLa (HeLa cell line) was used. Eur. J. Cell Biol. (0171-9335) 2004 Only protein-protein interactions imex curation de_wit-2004-4 Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl The library pJG-HeLa (HeLa cell line) was used. Eur. J. Cell Biol. (0171-9335) 2004 Only protein-protein interactions imex curation dylt1_human Dynein light chain Tctex-type 1 T-complex testis-specific protein 1 homolog Protein CW-1 DYNLT1 TCTEL1 TCTEX1 TCTEX-1 protein protein human Homo sapiens Human MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI hspb9_human Heat shock protein beta-9 Cancer/testis antigen 51 HSPB9 protein protein human Homo sapiens Human MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR hspb9_mouse Heat shock protein beta-9 Hspb9 protein protein mouse Mus musculus Mouse MQRVGSSFSTGQREPGENRVASRCPSVALAERNQVATLPVRLLRDEVQGNGCEQPSFQIKVDAQGFAPEDLVVRIDGQNLTVTGQRQHESNDPSRGRYRMEQSVHRQMQLPPTLDPAAMTCSLTPSGHLWLRGQNKCLPPPEAQTGQSQKPRRGGPKSSLQNESVKNP ctcf_human Transcriptional repressor CTCF CCCTC-binding factor CTCFL paralog 11-zinc finger protein CTCF protein protein human Homo sapiens Human MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR nudt5_human ADP-sugar pyrophosphatase Nucleoside diphosphate-linked moiety X motif 5 YSA1H NUDT5 HSPC115 8-oxo-dGDP phosphatase NUDIX5 Nuclear ATP-synthesis protein NUDIX5 protein protein human Homo sapiens Human MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF hspb9-dynlt1-2 A C-terminal construct of HSPB9 interacted with TCTEL1 in a yeast two hybrid assay 572916 N/A 572920 unspecified role unspecified role prey prey N/A 572921 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 4 hspb9-dynlt1-3 Murine HSPB9 interacted with human TCTEL1 in a yeast two hybrid assay 572916 N/A 572920 unspecified role unspecified role prey prey N/A 572922 unspecified role unspecified role bait bait physical association physical association false false false Table 4 The interaction of human TCTEL1 with mouse HSPB9 was not as strong as with human HSPB9. dynlt1-dynlt1 TCTEL1 interacted with itself in a yeast two hybrid assay 572916 N/A 572920 unspecified role unspecified role bait bait N/A 572920 unspecified role unspecified role prey prey physical association physical association false false false Table 4 hspb9-dynlt1-4 A C-terminal construct of HSPB9 interacted with TCTEL1 in a yeast two hybrid assay 572916 N/A 572921 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 572920 unspecified role unspecified role bait bait physical association physical association false false false Table 4 hspb9-dynlt1-5 Murine HSPB9 interacted with human TCTEL1 in a yeast two hybrid assay 572916 N/A 572920 unspecified role unspecified role bait bait N/A 572922 unspecified role unspecified role prey prey physical association physical association false false false Table 4 The interaction of human TCTEL1 with mouse HSPB9 was not as strong as with human HSPB9. hspb9-dynlt1 HSPB9 interacted with TCTEL1 in a yeast two hybrid assay 572917 N/A 572920 unspecified role unspecified role prey prey N/A 572921 unspecified role unspecified role bait bait physical association physical association false false false Table 4 hspb9-ctcf HSPB9 interacted with CTCF in a yeast two hybrid assay 572917 N/A 572921 unspecified role unspecified role bait bait N/A 572923 unspecified role unspecified role prey prey physical association physical association false false false Table 4 hspb9-nudt5 HSPB9 interacted with NUDT5 in a yeast two hybrid assay 572917 N/A 572924 unspecified role unspecified role prey prey N/A 572921 unspecified role unspecified role bait bait physical association physical association false false false Table 4 hspb9-dynlt1-1 HSPB9 interacted with TCTEL1 in a yeast two hybrid assay 572918 N/A 572921 unspecified role unspecified role bait bait N/A 572920 unspecified role unspecified role prey prey physical association physical association false false false Table 4 hspb9-dynlt1-6 TCTEL1 coimmunoprecipitated with HSPB9 in HeLa cells 572919 N/A 572921 unspecified role unspecified role bait bait N/A 572920 unspecified role unspecified role prey prey region VSV tag (EIYTDIEMNRLGK) tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 Q9BQS6; P63172 transfection