IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lee-2004e-1 KAI1 COOH-terminal interacting tetraspanin (KITENIN), a member of the tetraspanin family, interacts with KAI1, a tumor metastasis suppressor, and enhances metastasis of cancer. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Park SR., Chay KO., Seo YW., Kook H., Ahn KY., Kim YJ., Kim KK. Cancer - Interactions investigated in the context of cancer kimkk@chonnam.ac.kr. A human lung cancer cDNA library was used in this study Cancer Res. (0008-5472) 2004 lee-2004e-2 KAI1 COOH-terminal interacting tetraspanin (KITENIN), a member of the tetraspanin family, interacts with KAI1, a tumor metastasis suppressor, and enhances metastasis of cancer. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Park SR., Chay KO., Seo YW., Kook H., Ahn KY., Kim YJ., Kim KK. Cancer - Interactions investigated in the context of cancer Directed yeast two hybrid. Figure 1 (C) Figure (D) kimkk@chonnam.ac.kr. A human lung cancer cDNA library was used in this study Cancer Res. (0008-5472) 2004 lee-2004e-3 KAI1 COOH-terminal interacting tetraspanin (KITENIN), a member of the tetraspanin family, interacts with KAI1, a tumor metastasis suppressor, and enhances metastasis of cancer. human-ct_26 Human colon carcinoma cell line ct_26 Human colon carcinoma cell line Human colon carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee JH., Park SR., Chay KO., Seo YW., Kook H., Ahn KY., Kim YJ., Kim KK. Cancer - Interactions investigated in the context of cancer The CT-26 human colon carcinoma cell line was established which stably expressed the VANGL1 protein. Figure 2(D) kimkk@chonnam.ac.kr. A human lung cancer cDNA library was used in this study Cancer Res. (0008-5472) 2004 lee-2004e-4 KAI1 COOH-terminal interacting tetraspanin (KITENIN), a member of the tetraspanin family, interacts with KAI1, a tumor metastasis suppressor, and enhances metastasis of cancer. human-km12c Human corectal carcinoma cell line km12c Human corectal cancer cell line fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Lee JH., Park SR., Chay KO., Seo YW., Kook H., Ahn KY., Kim YJ., Kim KK. Cancer - Interactions investigated in the context of cancer Figure 2(E) kimkk@chonnam.ac.kr. A human lung cancer cDNA library was used in this study Cancer Res. (0008-5472) 2004 vang1_human Vang-like protein 1 Van Gogh-like protein 1 Strabismus 2 Loop-tail protein 2 homolog VANGL1 STB2 protein protein human Homo sapiens Human MDTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPILWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV cd82_human CD82 antigen Inducible membrane protein R2 C33 antigen IA4 Metastasis suppressor Kangai-1 Suppressor of tumorigenicity 6 protein Tetraspanin-27 CD82 KAI1 SAR2 TSPAN27 ST6 protein protein human Homo sapiens Human MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY cd82-vangl1 Yeast 2 hybrid analysis reveals interaction between the CD82 protein and VANGL1 protein 217671 N/A 217675 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 217676 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false vangl1-cd82 Yeast 2 hybrid analysis reveals interaction between the VANGL1 protein and the CD82 protein 217671 N/A 217675 unspecified role unspecified role bait bait N/A 217676 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false cd82-vangl1-1 Directed yeast 2 hybrid analysis reveals interaction between the CD82 protein and VANGL1 protein 217672 N/A 217676 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 217675 unspecified role unspecified role prey prey physical association physical association false false false The binding region of CD82 is annotated as potential extracellular (111- 228 amino acid residues) and transmembrane (229-250 amino acid residues. vangl1-cd82-1 Directed yeast 2 hybrid analysis reveals interaction between the CD82 protein and VANGL1 protein 217672 N/A 217675 unspecified role unspecified role bait bait N/A 217676 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false vangl1-cd82-2 Coimmunoprecipitation analysis reveals interaction between the VANGL1 protein and the CD82 protein 217673 N/A 217675 unspecified role unspecified role bait bait N/A 217676 unspecified role unspecified role prey prey physical association physical association false false false cd82-vangl1-2 Co-localisation analysis reveals interaction between the CD82 protein and VANGL1 protein 217674 N/A 217675 unspecified role unspecified role neutral component neutral component N/A 217676 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false The stainingpatterns of KAI1 overlapped with fluorescent KITENIN at the edgesof the KM12C cells, indicating that KITENIN was present on the cell surface and colocalized with KAI1