IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cui-2003a-1 ECRG2, a novel candidate of tumor suppressor gene in the esophageal carcinoma, interacts directly with metallothionein 2A and links to apoptosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cui Y., Wang J., Zhang X., Lang R., Bi M., Guo L., Lu SH. Cancer - Interactions investigated in the context of cancer shlu@public.bta.net.cn A human fetal liver yeast two-hybrid cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation cui-2003a-3 ECRG2, a novel candidate of tumor suppressor gene in the esophageal carcinoma, interacts directly with metallothionein 2A and links to apoptosis. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cui Y., Wang J., Zhang X., Lang R., Bi M., Guo L., Lu SH. Cancer - Interactions investigated in the context of cancer shlu@public.bta.net.cn A human fetal liver yeast two-hybrid cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation cui-2003a-2 ECRG2, a novel candidate of tumor suppressor gene in the esophageal carcinoma, interacts directly with metallothionein 2A and links to apoptosis. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cui Y., Wang J., Zhang X., Lang R., Bi M., Guo L., Lu SH. Cancer - Interactions investigated in the context of cancer It was found that ECGR2 is the same as SPINK7 by using SRS to search (All Text) for the GenBank Accession No. AF268198 given for the ECGR2 gene in the introduction. shlu@public.bta.net.cn A human fetal liver yeast two-hybrid cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation cui-2003a-4 ECRG2, a novel candidate of tumor suppressor gene in the esophageal carcinoma, interacts directly with metallothionein 2A and links to apoptosis. human-ec109 Homo sapiens esophageal cancer cell line ec109 human esophageal cancer cell line confocal microscopy confocal microscopy immunostaining immunostaining Cui Y., Wang J., Zhang X., Lang R., Bi M., Guo L., Lu SH. Cancer - Interactions investigated in the context of cancer shlu@public.bta.net.cn A human fetal liver yeast two-hybrid cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation mt2_human Metallothionein-2 Metallothionein-II Metallothionein-2A MT2A CES1 MT2 protein protein human Homo sapiens Human MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA isk7_human Serine protease inhibitor Kazal-type 7 Esophagus cancer-related gene 2 protein SPINK7 ECG2 UNQ745/PRO1474 protein protein human Homo sapiens Human MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC q8izw4_human protein protein human Homo sapiens Human RRARCWHKAPERQRQGLKPGFSWAGADAQSGVGSCHLGNCWDLQSQRCHLHSMVLILPASWPEGHPDHKSGGLSVCLHLPQRCLLSFPTHSSLFGVRGGTGQLAQDLLIIAAQVFE mt1h_human Metallothionein-1H MT1H Metallothionein-IH Metallothionein-0 protein protein human Homo sapiens Human MDPNCSCEAGGSCACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCICKGASEKCSCCA mt1g_human Metallothionein-1G Metallothionein-IG Metallothionein-1K MT1G MT1K MT1M protein protein human Homo sapiens Human MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA epb42_human Protein 4.2 EPB42 E42P Erythrocyte membrane protein band 4.2 protein protein human Homo sapiens Human MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSKDKQVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQEGALLNKRRGSVPILRQWLTGRGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFASAQGTGGRLLIDEYYNEEGLQNGEGQRGRIWIFQTSTECWMTRPALPQGYDGWQILHPSAPNGGGVLGSCDLVPVRAVKEGTLGLTPAVSDLFAAINASCVVWKCCEDGTLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSLPLRGDAQISVTLVNHSEQEKAVQLAIGVQAVHYNGVLAAKLWRKKLHLTLSANLEKIITIGLFFSNFERNPPENTFLRLTAMATHSESNLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA rt12_human 28S ribosomal protein S12, mitochondrial MT-RPS12 MRPS12 RPMS12 RPSM12 Mitochondrial small ribosomal subunit protein uS12m protein protein human Homo sapiens Human MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK rabl6_human Rab-like protein 6 RABL6 C9orf86 GTP-binding protein Parf PARF Partner of ARF Rab-like protein 1 protein protein human Homo sapiens Human MFSALKKLVGSDQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDMDATLEELSVQQETEDQNYGIFLEMMEARSRGHASPLAANGQSPSPGSQSPVVPAGAVSTGSSSPGTPQPAPQLPLNAAPPSSVPPVPPSEALPPPACPSAPAPRRSIISRLFGTSPATEAAPPPPEPVPAAEGPATVQSVEDFVPDDRLDRSFLEDTTPARDEKKVGAKAAQQDSDSDGEALGGNPMVAGFQDDVDLEDQPRGSPPLPAGPVPSQDITLSSEEEAEVAAPTKGPAPAPQQCSEPETKWSSIPASKPRRGTAPTRTAAPPWPGGVSVRTGPEKRSSTRPPAEMEPGKGEQASSSESDPEGPIAAQMLSFVMDDPDFESEGSDTQRRADDFPVRDDPSDVTDEDEGPAEPPPPPKLPLPAFRLKNDSDLFGLGLEEAGPKESSEEGKEGKTPSKEKKKKKKKGKEEEEKAAKKKSKHKKSKDKEEGKEERRRRQQRPPRSRERTAADELEAFLGGGAPGGRHPGGGDYEEL spink7-mt2a ECRG2 interacts with MT2A in a yeast two hybrid assay 575506 N/A 575510 unspecified role unspecified role prey prey N/A 575511 unspecified role unspecified role bait bait physical association physical association false false false Table 1 spink7-q8izw4 ECRG2 interacts with AF422192 in a yeast two hybrid assay 575506 N/A 575511 unspecified role unspecified role bait bait N/A 575512 unspecified role unspecified role prey prey physical association physical association false false false Table 1 spink7-mt1h ECRG2 interacts with mt1h in a yeast two hybrid assay 575506 N/A 575513 unspecified role unspecified role prey prey N/A 575511 unspecified role unspecified role bait bait physical association physical association false false false Table 1 spink7-mt1g ECRG2 interacts with mt1g in a yeast two hybrid assay 575506 N/A 575511 unspecified role unspecified role bait bait N/A 575514 unspecified role unspecified role prey prey physical association physical association false false false Table 1 spink7-ebp42 ECRG2 interacts with EMBP4.2 in a yeast two hybrid assay 575506 N/A 575515 unspecified role unspecified role prey prey N/A 575511 unspecified role unspecified role bait bait physical association physical association false false false Table 1 spink7-mrps12 ECRG2 interacts with mitochondrial ribosomal protein S12 in a yeast two hybrid assay 575506 N/A 575511 unspecified role unspecified role bait bait N/A 575516 unspecified role unspecified role prey prey physical association physical association false false false Table 1 spink7-parf ECRG2 interacts with FLJ10101 in a yeast two hybrid assay 575506 N/A 575517 unspecified role unspecified role prey prey N/A 575511 unspecified role unspecified role bait bait physical association physical association false false false Table 1 mt2a-spink7 FLAG-ECRG2 coimmunoprecipitates with HA-MT2A in HEK-293 cell lysates 575507 N/A 575510 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 575511 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 A spink7-mt2a-2 HA-MT2A coimmunoprecipitates with FLAG-ECRG2 in HEK-293 cell lysates 575507 N/A 575510 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 575511 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 B spink7-mt2a-1 GST-ECRG2 pulls down HA-MT2A in vitro 575508 N/A 575510 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 575511 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 C spink7-mt2a-3 ECRG2 and MT2A colocalize in EC109 cells 575509 N/A 575510 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 575511 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 3 C