IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ohkura-2001-2 Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. nohkura@gan2.ncc.go.jp Biochem. Biophys. Res. Commun. (0006-291X) 2001 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer The cDNA library used was made from rat fetal forebrain embryonic day 17 (E17) polyA+ RNA. This is because rat MEN1 expression is strongest in the fetal forebrain at embryonic day 14-18. ohkura-2001-1 Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. nohkura@gan2.ncc.go.jp The cDNA library used was made from rat fetal forebrain embryonic day 17 (E17) polyA+ RNA. This is because rat MEN1 expression is strongest in the fetal forebrain at embryonic day 14-18. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer ohkura-2001-3 Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. nohkura@gan2.ncc.go.jp Biochem. Biophys. Res. Commun. (0006-291X) 2001 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer The cDNA library used was made from rat fetal forebrain embryonic day 17 (E17) polyA+ RNA. This is because rat MEN1 expression is strongest in the fetal forebrain at embryonic day 14-18. ohkura-2001-4 Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. nohkura@gan2.ncc.go.jp Biochem. Biophys. Res. Commun. (0006-291X) 2001 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer The cDNA library used was made from rat fetal forebrain embryonic day 17 (E17) polyA+ RNA. This is because rat MEN1 expression is strongest in the fetal forebrain at embryonic day 14-18. ndka_rat Nucleoside diphosphate kinase A Tumor metastatic process-associated protein Metastasis inhibition factor NM23 Nme1 protein protein rat Rattus norvegicus (Rat) Rat MANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFIQASEDLLKEHYIDLKDRPFFSGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEISLWFQPEELVDYKSCAQNWIYE o00255-2 Menin Short MEN1 SCG2 protein protein human Homo sapiens Human MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPEEPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPTASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL nme1-men1 GST-nm23 pulls down Men1 568389 N/A 568393 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35S-methionine labeled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 568394 unspecified role unspecified role prey prey region 35S-methionine labeled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 1 A men1-nme1-2 GST-menin pulls down nm23 568389 N/A 568393 unspecified role unspecified role prey prey region 35S-methionine labeled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 568394 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35S-methionine labeled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 1 B men1-nme1 In a yeast two-hybrid assay Menin binds nm23 568390 N/A 568393 unspecified role unspecified role prey prey N/A 568394 unspecified role unspecified role bait bait physical association physical association false false false nme1-men1-1 GST-nm23 pulls down Men1 expressed in Cos-7 cells 568391 N/A 568393 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 568394 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association false false false men1-nme1-1 In a yeast two-hybrid assay Menin binds nm23 568392 N/A 568394 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O00255-2:p.Pro12Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O00255-2:p.His139Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O00255-2:p.Pro320Leu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 568393 unspecified role unspecified role prey prey physical association physical association false false false 3, 4 Menin constructs truncated beyond residue 486 at the C-terminus and constructs with regions deleted at the N-terminus did not bind nm23. The authors state that this indicates that almost all of the protein is required for binding to nm23. When lys-119 in Menin was deleted this also abolished the interaction with nm23.