IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ terai-2000-1 Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Terai S., Aoki H., Ashida K., Thorgeirsson SS. Cancer - Interactions investigated in the context of cancer snorri_thorgeirsson@nih.gov Human fetal liver (Clontech). Hepatology (0270-9139) 2000 Only protein-protein interactions imex curation terai-2000-3 Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Terai S., Aoki H., Ashida K., Thorgeirsson SS. Cancer - Interactions investigated in the context of cancer snorri_thorgeirsson@nih.gov Human fetal liver (Clontech). Hepatology (0270-9139) 2000 Only protein-protein interactions imex curation terai-2000-2 Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Terai S., Aoki H., Ashida K., Thorgeirsson SS. Cancer - Interactions investigated in the context of cancer snorri_thorgeirsson@nih.gov Human fetal liver (Clontech). Hepatology (0270-9139) 2000 Only protein-protein interactions imex curation p15923-1 Transcription factor E2-alpha PAN-2 TCF3 BHLHB21 E2A ITF1 Class B basic helix-loop-helix protein 21 Immunoglobulin enhancer-binding factor E12/E47 Immunoglobulin transcription factor 1 Kappa-E2-binding factor Transcription factor 3 Transcription factor ITF-1 protein protein human Homo sapiens Human MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM ccdb1_human Cyclin-D1-binding protein 1 Grap2 and cyclin-D-interacting protein Human homolog of Maid CCNDBP1 DIP1 GCIP HHM protein protein human Homo sapiens Human MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAAVTVSREATTLTIVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRGATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQELIIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL id1_human DNA-binding protein inhibitor ID-1 ID1 ID Inhibitor of DNA binding 1 BHLHB24 Class B basic helix-loop-helix protein 24 Inhibitor of differentiation 1 protein protein human Homo sapiens Human MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR id2_human DNA-binding protein inhibitor ID-2 Inhibitor of DNA binding 2 ID2 BHLHB26 Class B basic helix-loop-helix protein 26 Inhibitor of differentiation 2 protein protein human Homo sapiens Human MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG id3_human DNA-binding protein inhibitor ID-3 ID3 1R21 BHLHB25 Inhibitor of DNA binding 3 ID-like protein inhibitor HLH 1R21 Helix-loop-helix protein HEIR-1 HEIR1 Class B basic helix-loop-helix protein 25 Inhibitor of differentiation 3 protein protein human Homo sapiens Human MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH a1at_human Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase AAT PI PRO0684 PRO2209 SERPINA1 Serpin A1 protein protein human Homo sapiens Human MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK myod1_human Myoblast determination protein 1 Myogenic factor 3 MYOD1 MYF3 MYOD BHLHC1 Class C basic helix-loop-helix protein 1 protein protein human Homo sapiens Human MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPEEHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQSPDAAPQCPAGANPNPIYQVL tcf3-ccndbp1 TCF3 (E12) and CCNDBP1 (HMM) interact in a yeast two-hybrid assay 733735 N/A 733738 unspecified role unspecified role bait bait N/A 733739 unspecified role unspecified role prey prey physical association physical association false false false tcf3-id1 TCF3 (E12) and ID1 interact in a yeast two-hybrid assay 733735 N/A 733738 unspecified role unspecified role bait bait N/A 733740 unspecified role unspecified role prey prey physical association physical association false false false tcf3-id2 TCF3 (E12) and ID2 interact in a yeast two-hybrid assay 733735 N/A 733738 unspecified role unspecified role bait bait N/A 733741 unspecified role unspecified role prey prey physical association physical association false false false tcf3-id3 TCF3 (E12) and ID3 interact in a yeast two-hybrid assay 733735 N/A 733742 unspecified role unspecified role prey prey N/A 733738 unspecified role unspecified role bait bait physical association physical association false false false tcf3-serpina1 TCF3 (E12) and SERPINA1 (Alpha-1-antitrypsin) interact in a yeast two-hybrid assay 733735 N/A 733743 unspecified role unspecified role prey prey N/A 733738 unspecified role unspecified role bait bait physical association physical association false false false tcf3-ccndbp1-2 TCF3 (E12) and CCNDBP1 (HMM) interact in a coimmunoprecipitation 733736 n/a 733738 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 733739 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro 733766 733763 physical association physical association false false false Fig. 4D tcf3-id2-2 TCF3 (E12) and ID2 interact in a coimmunoprecipitation 733736 n/a 733738 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 733741 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 4D tcf3-myod1-1 TCF3 (E12) and MYOD1 interact in a coimmunoprecipitation 733736 n/a 733744 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 733738 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 4D tcf3-tcf3-1 TCF3 (E12) homodimerizes in a coimmunoprecipitation 733736 n/a 733738 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 733738 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 4D tcf3-ccndbp1-1 TCF3 (E12) and CCNDBP1 (HMM) interact in a coimmunoprecipitation 733737 n/a 733738 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 733739 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4B tcf3-id2-1 TCF3 (E12) and ID2 interact in a coimmunoprecipitation 733737 n/a 733741 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 733738 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4B myod1-tcf3-1 TCF3 (E12) and MYOD1 interact in a coimmunoprecipitation 733737 n/a 733744 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 733738 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4B