IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhao-2000-2 MAGOH interacts with a novel RNA-binding protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhao XF., Nowak NJ., Shows TB., Aplan PD. Cancer - Interactions investigated in the context of cancer aplanp@mail.nih.gov A human fetal brain cDNA library was used. Genomics (0888-7543) 2000 zhao-2000-1 MAGOH interacts with a novel RNA-binding protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhao XF., Nowak NJ., Shows TB., Aplan PD. Cancer - Interactions investigated in the context of cancer aplanp@mail.nih.gov A human fetal brain cDNA library was used. Genomics (0888-7543) 2000 zhao-2000-3 MAGOH interacts with a novel RNA-binding protein in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhao XF., Nowak NJ., Shows TB., Aplan PD. Cancer - Interactions investigated in the context of cancer aplanp@mail.nih.gov A human fetal brain cDNA library was used. Genomics (0888-7543) 2000 mgn_human Protein mago nashi homolog MAGOH MAGOHA protein protein human Homo sapiens Human MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI rbm8a_human RNA-binding protein 8A HSPC114 MDS014 RNA-binding motif protein 8A Ribonucleoprotein RBM8A RNA-binding protein Y14 Binder of OVCA1-1 RBM8A RBM8 protein protein human Homo sapiens Human MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR magoh-rbm8a-3 MAGOH and RBM8 interact in a yeast two-hybrid assay 670408 N/A 670411 unspecified role unspecified role bait bait N/A 670412 unspecified role unspecified role prey prey physical association physical association false false false 1 B PREY gene AF127761 rbm8a-magoh MAGOH and RBM8 interact in a yeast two-hybrid assay 670408 N/A 670412 unspecified role unspecified role bait bait N/A 670411 unspecified role unspecified role prey prey physical association physical association false false false 1 B PREY gene AF127761 magoh-rbm8a MAGOH and RBM8 interact in a yeast two-hybrid assay 670409 N/A 670411 unspecified role unspecified role bait bait N/A 670412 unspecified role unspecified role prey prey physical association physical association false false false PREY gene AF127761 magoh-rbm8a-4 MAGOH pulls down RBM8 in vitro 670410 N/A 670412 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 670411 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false PREY gene AF127761 1 C