MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint luscher_fir-1999-2 Interaction of the fork head domain transcription factor MPP2 with the human papilloma virus 16 E7 protein: enhancement of transformation and transactivation. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Luscher-Firzlaff JM., Westendorf JM., Zwicker J., Burkhardt H., Henriksson M., Muller R., Pirollet F., Luscher B. Cancer - Interactions investigated in the context of cancer 3a A library of cDNA fragments derived from 9.5-10.5 days post-coitus CD1 mouse embryos was used. Oncogene (0950-9232) 1999 luscher_fir-1999-1 Interaction of the fork head domain transcription factor MPP2 with the human papilloma virus 16 E7 protein: enhancement of transformation and transactivation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Luscher-Firzlaff JM., Westendorf JM., Zwicker J., Burkhardt H., Henriksson M., Muller R., Pirollet F., Luscher B. Cancer - Interactions investigated in the context of cancer A library of cDNA fragments derived from 9.5-10.5 days post-coitus CD1 mouse embryos was used. Oncogene (0950-9232) 1999 luscher_fir-1999-3 Interaction of the fork head domain transcription factor MPP2 with the human papilloma virus 16 E7 protein: enhancement of transformation and transactivation. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Luscher-Firzlaff JM., Westendorf JM., Zwicker J., Burkhardt H., Henriksson M., Muller R., Pirollet F., Luscher B. Cancer - Interactions investigated in the context of cancer 4 A library of cDNA fragments derived from 9.5-10.5 days post-coitus CD1 mouse embryos was used. Oncogene (0950-9232) 1999 ve7_hpv16 Protein E7 E7 protein protein hpv16 Human papillomavirus type 16 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP q08050-1 Forkhead box protein M1 FOXM1 FKHL16 HFH11 MPP2 WIN Forkhead-related protein FKHL16 Hepatocyte nuclear factor 3 forkhead homolog 11 M-phase phosphoprotein 2 MPM-2 reactive phosphoprotein 2 Transcription factor Trident Winged-helix factor from INS-1 cells FOXM1-c FoxM1C protein protein human Homo sapiens Human MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELPLGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIAPKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ foxm1_mouse Forkhead box protein M1 Forkhead homolog 16 Winged-helix transcription factor Trident Foxm1 Fkh16 protein protein mouse Mus musculus Mouse MRTSPRRPLILKRRRLPLPVQNAPSETSEEEAKRSPAQPEPAPAQASQEVAESSSCKFPAGIKIINHPTTPNTQVVAIPSNADIQSIITALTAKGKESGTSGPNRFILISSGGPSSHPSQPQAHSSRDSKRAEVITETLGPKPAAKGVPVPKPPGAPPRQRQESYAGGEAAGCTLDNSLTNIQWLGKMSSDGLGPCSVKQELEEKENCHLEQNRVKVEEPSGVSTSWQDSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRHLTLDQVFKPLEPGSPQSPEHLESQQKRPNPELHRNVTIKTEIPLGARRKMKPLLPRVSSYLEPIQFPVNQSLVLQPSVKVPFRLAASLMSSELARHSKRVRIAPKVLLSSEGIAPLPATEPPKEEKPLLGGEGLLPLLPIQSIKEEEMQPEEDIAHLERPIKVESPPLEEWPSPCASLKEELSNSWEDSSCSPTPKPKKSYCGLKSPTRCVSEMLVTKRREKREVSRSRRKQHLQPPCLDEPDLFFPEDSSTFRPAVELLAESSEPAPHLSCPQEEGGPFKTPIKETLPVSSTPSKSVLSRDPESWRLTPPAKVGGLDFSPVRTPQGAFGLLPDSLGLMELNTTPLKSGPLFDSPRELLNSEPFDLASDPFGSPPPPHVEGPKPGSPELQIPSLSANRSLTEGLVLDTMNDSLSKILLDISFPGLEEDPLGPDNINWSQFIPELR e7-mpp2-2 Interaction between HPV16 E7 and human MPP2 detected by pulldown 256461 N/A 256464 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 256465 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mpp2-e7-1 Interaction between human MPP2 and HPV16 E7 detected by pulldown 256461 N/A 256465 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 256464 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false e7-mpp2-1 Interaction between HPV16 E7 and mouse MPP2 detected by Y2H 256462 N/A 256466 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 256464 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mpp2-e7-2 Interaction between human MPP2 and HPV16 E7 detected by coIP 256463 N/A 256464 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 256465 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false