IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yang-1999-1 NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yang JP., Hori M., Takahashi N., Kawabe T., Kato H., Okamoto T. Apoptosis - Interactions involving proteins with a function related to apoptosis Isoform 2 of TP53BP2 was used as 1005 aa is the length of the protein documented in these experiments. Human placenta and brain cDNA libraries were used. Oncogene (0950-9232) 1999 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer yang-1999-2 NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yang JP., Hori M., Takahashi N., Kawabe T., Kato H., Okamoto T. Apoptosis - Interactions involving proteins with a function related to apoptosis The species of origin of the proteins, p53 and T-antigen, could not be ascertained. Thus interactions involving these proteins could not be curated. Isoform 2 of TP53BP2 was used as 1005 aa is the length of the protein documented in these experiments. Oncogene (0950-9232) 1999 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer Human placenta and brain cDNA libraries were used. yang-1999-3 NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yang JP., Hori M., Takahashi N., Kawabe T., Kato H., Okamoto T. Apoptosis - Interactions involving proteins with a function related to apoptosis Isoform 2 of TP53BP2 was used as this is the length of the protein documented in these experiments. Oncogene (0950-9232) 1999 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer Isoform 2 of TP53BP2 was used as 1005 aa is the length of the protein documented in these experiments. Human placenta and brain cDNA libraries were used. yang-1999-4 NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yang JP., Hori M., Takahashi N., Kawabe T., Kato H., Okamoto T. Apoptosis - Interactions involving proteins with a function related to apoptosis Isoform 2 of TP53BP2 was used as 1005 aa is the length of the protein documented in these experiments. Oncogene (0950-9232) 1999 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer Human placenta and brain cDNA libraries were used. yang-1999-5 NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yang JP., Hori M., Takahashi N., Kawabe T., Kato H., Okamoto T. Apoptosis - Interactions involving proteins with a function related to apoptosis Isoform 2 of TP53BP2 was used as this is the length of the protein documented in these experiments. Oncogene (0950-9232) 1999 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer Isoform 2 of TP53BP2 was used as 1005 aa is the length of the protein documented in these experiments. Human placenta and brain cDNA libraries were used. yang-1999-6 NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Yang JP., Hori M., Takahashi N., Kawabe T., Kato H., Okamoto T. Apoptosis - Interactions involving proteins with a function related to apoptosis EGFP-53BP2 was visualized using its fluorescent tag and RelA (p65) was visualized using immunostaining. Isoform 2 of TP53BP2 was used as 1005 aa is the length of the protein documented in these experiments. Oncogene (0950-9232) 1999 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer Human placenta and brain cDNA libraries were used. ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS ikbb_human NF-kappa-B inhibitor beta NFKBIB IKBB TRIP9 I-kappa-B-beta Thyroid receptor-interacting protein 9 protein protein human Homo sapiens Human MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGSAMLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPRPV nfkb1_human Nuclear factor NF-kappa-B p105 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI rel_human Proto-oncogene c-Rel REL protein protein human Homo sapiens Human MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV q13625-2 Apoptosis-stimulating of p53 protein 2 TP53BP2 ASPP2 BBP Bcl2-binding protein Renal carcinoma antigen NY-REN-51 Tumor suppressor p53-binding protein 2 Bbp protein protein human Homo sapiens Human MDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA Due to Alu sequence insertion that creates a shorter but existing form that may have an alternative function. rela-nfkbia-4 RelA (p65) interacts with NFKBIA (IkappaBalpha) in a yeast two-hybrid assay 730577 N/A 730583 unspecified role unspecified role prey prey N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false It is not clear whether this interaction was found in the screen of the brain or placenta cDNA library, or both. rela-nfkbib-8 RelA (p65) interacts with NFKBIB (IkappaBbeta) in a yeast two-hybrid assay 730577 N/A 730585 unspecified role unspecified role prey prey N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false It is not clear whether this interaction was found in the screen of the brain or placenta cDNA library, or both. rela-nfkb1-8 RelA (p65) interacts with NFKB1 (p105) in a yeast two-hybrid assay 730577 N/A 730586 unspecified role unspecified role prey prey N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false It is not clear whether this interaction was found in the screen of the brain or placenta cDNA library, or both. rela-rel-1 RelA (p65) interacts with Rel (c-Rel) in a yeast two-hybrid assay 730577 N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 730587 unspecified role unspecified role prey prey physical association physical association false false false It is not clear whether this interaction was found in the screen of the brain or placenta cDNA library, or both. rela-rela-4 RelA (p65) forms homo-oligomers in a yeast two-hybrid assay 730577 N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 730584 unspecified role unspecified role prey prey physical association physical association false false false It is not clear whether this interaction was found in the screen of the brain or placenta cDNA library, or both. rela-tp53bp2 RelA (p65) interacts with TP53BP2 in a yeast two-hybrid assay 730577 N/A 730588 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false This interaction was found in both the screen of the placenta library (TP53BP2 aa 477-1005)and the screen of the brain library (TP53BP2 aa 227-1005). rela-nfkbia-5 RelA (p65) interacts with NFKBIA (IkappaBalpha) in a directed yeast two-hybrid assay 730578 N/A 730583 unspecified role unspecified role prey prey N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false rela-tp53bp2-1 RelA (p65) interacts with TP53BP2 in a directed yeast two-hybrid assay 730578 N/A 730588 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 This interaction is stronger than the RelA (176-405)-RelA (176-405) interaction. rela-rela-5 RelA (p65) forms homo-oligomers in a directed yeast two-hybrid assay 730578 N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 730584 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 rela-rel-2 RelA (p65) interacts with Rel (c-Rel) in a directed yeast two-hybrid assay 730578 N/A 730587 unspecified role unspecified role prey prey N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false rela-nfkbib-9 RelA (p65) interacts with NFKBIB (IkappaBbeta) in a directed yeast two-hybrid assay 730578 N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 730585 unspecified role unspecified role prey prey physical association physical association false false false rela-nfkb1-9 RelA (p65) interacts with NFKB1 (p105) in a directed yeast two-hybrid assay 730578 N/A 730584 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 730586 unspecified role unspecified role prey prey physical association physical association false false false rela-tp53bp2-2 TP53BP2 pulls down RelA (p65) in vitro 730579 N/A 730588 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 730584 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 1 rela-tp53bp2-3 TP53BP2 and RelA (p65) in a mammalian two-hybrid assay 730580 N/A 730584 unspecified role unspecified role prey prey in vitro In vitro N/A 730588 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3 A Q13625-2; Q04206 transfection rela-tp53bp2-4 TP53BP2 and RelA (p65) in a mammalian two-hybrid assay 730581 N/A 730588 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 730584 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 3 B Q13625-2; Q04206 transfection rela-tp53bp2-5 TP53BP2 and RelA (p65) colocalize in HeLa cells 730582 N/A 730588 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 730584 unspecified role unspecified role neutral component neutral component in vitro In vitro physical association physical association false false false 5 Q13625-2 transfection