MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint roder-1999-3 Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer Assays were carried out in the two-hybrid reporter yeast strain pJ69-4A. 1 michael.schweizer@bbsrc.ac.uk Gene (0378-1119) 1999 roder-1999-2 Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer Assays were carried out in the two-hybrid reporter yeast strain HF7c. 1 michael.schweizer@bbsrc.ac.uk Gene (0378-1119) 1999 roder-1999-4 Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk Gene (0378-1119) 1999 roder-1999-5 Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. rat-h4iie Rat hepatoma cell line H4IIE h4iie Rat hepatoma cell line H4IIE anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk Gene (0378-1119) 1999 roder-1999-1 Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk Gene (0378-1119) 1999 nfya_mouse Nuclear transcription factor Y subunit alpha Nuclear transcription factor Y subunit A CAAT box DNA-binding protein subunit A Nfya protein protein mouse Mus musculus Mouse MEQYTTNSNSSTEQIVVQAGQIQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS sp1_human Transcription factor Sp1 SP1 TSFP1 protein protein human Homo sapiens Human MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF nfya_rat Nuclear transcription factor Y subunit alpha Nuclear transcription factor Y subunit A CAAT box DNA-binding protein subunit A Nfya CCAAT-binding transcription factor subunit A protein protein rat Rattus norvegicus (Rat) Rat MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS sp1_rat Transcription factor Sp1 Sp1 protein protein rat Rattus norvegicus (Rat) Rat MSDQDHSMDEVTAVKIEKGVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGNSTNGSNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESGSQPVTSGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTSQRVGGLQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHQLPGLPLAIANTPGDHGAQLGLHGPGGDGIHDETAGGEEGENSPDPQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCNWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSINISGNGF nfya-sp1-8 Interaction between mouse NF-YA and human Sp1 detected by beta-galactosidase assay 2077 N/A 2082 unspecified role unspecified role bait bait in vitro In vitro N/A 2083 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false nfya-sp1-9 Interaction between mouse NF-YA deletion and human Sp1 detected by beta-galactosidase assay 2077 N/A 2083 unspecified role unspecified role prey prey in vitro In vitro N/A 2082 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false sp1-nfya-1 Interaction between human Sp1 and mouse NF-YA detected by beta-galactosidase assay 2077 N/A 2083 unspecified role unspecified role bait bait in vitro In vitro N/A 2082 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false nfya-sp1-10 Interaction between mouse NF-YA deletion and human Sp1 detected by beta-galactosidase assay 2077 N/A 2083 unspecified role unspecified role prey prey in vitro In vitro N/A 2082 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false nfya-sp1-11 Interaction between mouse NF-YA deletion and human Sp1 detected by beta-galactosidase assay 2077 N/A 2082 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2083 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false nfya-sp1-12 Interaction between mouse NF-YA and human Sp1 deletion detected by beta-galactosidase assay 2077 N/A 2083 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2082 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false nfya-sp1-13 Interaction between mouse NF-YA and human Sp1 deletion detected by beta-galactosidase assay 2077 N/A 2082 unspecified role unspecified role bait bait in vitro In vitro N/A 2083 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false nfya-sp1-14 Interaction between mouse NF-YA and human Sp1 deletion detected by beta-galactosidase assay 2077 N/A 2082 unspecified role unspecified role bait bait in vitro In vitro N/A 2083 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false nfya-sp1-15 Interaction between mouse NF-YA and human Sp1 deletion detected by beta-galactosidase assay 2077 N/A 2082 unspecified role unspecified role bait bait in vitro In vitro N/A 2083 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false nfya-sp1-16 Interaction between mouse NF-YA and human Sp1 deletion detected by beta-galactosidase assay 2077 N/A 2082 unspecified role unspecified role bait bait in vitro In vitro N/A 2083 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false nfya-sp1-17 Interaction between mouse NF-YA and human Sp1 deletion detected by beta-galactosidase assay 2077 N/A 2083 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2082 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false nfya-sp1-2 Interaction between mouse NF-YA and human Sp1 detected by beta-galactosidase assay 2078 N/A 2083 unspecified role unspecified role prey prey in vitro In vitro N/A 2082 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false nfya-sp1-3 Interaction between mouse NF-YA deletion and human Sp1 detected by beta-galactosidase assay 2078 N/A 2083 unspecified role unspecified role prey prey in vitro In vitro N/A 2082 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false nfya-sp1-4 Interaction between mouse NF-YA deletion and human Sp1 detected by beta-galactosidase assay 2078 N/A 2083 unspecified role unspecified role prey prey in vitro In vitro N/A 2082 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false nfya-sp1-5 Interaction between mouse NF-YA and human Sp1 deletion detected by beta-galactosidase assay 2078 N/A 2083 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2082 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false nfya-sp1-6 Interaction between mouse NF-YA and human Sp1 deletion detected by beta-galactosidase assay 2078 N/A 2082 unspecified role unspecified role bait bait in vitro In vitro N/A 2083 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false nfya-sp1-7 Interaction between mouse NF-YA and human Sp1 deletion detected by beta-galactosidase assay 2078 N/A 2083 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2082 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false sp1-sp1-1 Homodimerisation of human Sp1 detected by GST pulldown 2079 N/A 2083 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 2083 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false sp1-nfya-2 Interaction between human Sp1 and rat NF-YA detected by GST pulldown 2079 N/A 2084 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 2083 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false sp1-nfya-3 Interaction between rat Sp1 and rat NF-YA detected by coimmunoprecipitation 2080 N/A 2084 unspecified role unspecified role prey prey N/A 2085 unspecified role unspecified role bait bait physical association physical association false false false nfya-sp1-18 Interaction between rat NF-YA and rat Sp1 detected by coimmunoprecipitation 2080 N/A 2085 unspecified role unspecified role prey prey N/A 2084 unspecified role unspecified role bait bait physical association physical association false false false nfya-sp1-1 Interaction between mouse NF-YA and human Sp1 detected by Y2H 2081 N/A 2083 unspecified role unspecified role prey prey in vitro In vitro N/A 2082 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false