MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ohi-1999-2 A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis 2 nakajima.mco@dent.tmd.ac.jp A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used Cell Death Differ. (1350-9047) 1999 Cancer - Interactions investigated in the context of cancer ohi-1999-1 A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis 2 nakajima.mco@dent.tmd.ac.jp A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used Cell Death Differ. (1350-9047) 1999 Cancer - Interactions investigated in the context of cancer ohi-1999-3 A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis 2 nakajima.mco@dent.tmd.ac.jp A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used Cell Death Differ. (1350-9047) 1999 Cancer - Interactions investigated in the context of cancer ohi-1999-4 A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ohi N., Tokunaga A., Tsunoda H., Nakano K., Haraguchi K., Oda K., Motoyama N., Nakajima T. Apoptosis - Interactions involving proteins with a function related to apoptosis 2 nakajima.mco@dent.tmd.ac.jp A cDNA library from the human epidermoid carcinoma-derived cell line MA1 was used Cell Death Differ. (1350-9047) 1999 Cancer - Interactions investigated in the context of cancer bni3l_human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like NIP3-like protein X BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A Adenovirus E1B19K-binding protein B5 BNIP3L BNIP3A BNIP3H NIX protein protein human Homo sapiens Human MSSHLVEPPPPLHNNNNNCEENEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY bnip2_human BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 BNIP2 NIP2 protein protein human Homo sapiens Human MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ bnip3_human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 BNIP3 NIP3 protein protein human Homo sapiens Human MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF 53967696EDA005E2 p02545-2 Prelamin-A/C Lamin C LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHVSGSRR e1bs_ade02 E1B protein, small T-antigen E1B E1B 19 kDa protein E1B-175R protein protein ade02 Human adenovirus C serotype 2 (HAdV-2) Human adenovirus 2 HAdV-2 MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQEQSPWNPRAGLDPRE bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK p02545-1 Prelamin-A/C Lamin A LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNCSIM bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS b5-nip2-1 Interaction between human B5 and Nip2 detected by Y2H 328745 N/A 328749 unspecified role unspecified role bait bait N/A 328750 unspecified role unspecified role prey prey physical association physical association false false false b5-nip3-1 Interaction between human B5 and Nip3 detected by Y2H 328745 N/A 328751 unspecified role unspecified role prey prey N/A 328749 unspecified role unspecified role bait bait physical association physical association false false false b5-b5-1 Homodimerisation of human B5 detected by Y2H 328745 N/A 328749 unspecified role unspecified role bait bait N/A 328749 unspecified role unspecified role prey prey physical association physical association false false false b5-lamin_c-1 Interaction between human B5 and Lamin C detected by Y2H 328745 N/A 328752 unspecified role unspecified role prey prey N/A 328749 unspecified role unspecified role bait bait physical association physical association false false false b5-e1b19k-1 Interaction between human B5 and adenovirus E1B19K detected by Y2H 328745 N/A 328749 unspecified role unspecified role bait bait N/A 328753 unspecified role unspecified role prey prey physical association physical association false false false bcl_2-nip2-1 Interaction between human Bcl-2 and Nip2 detected by Y2H 328745 N/A 328754 unspecified role unspecified role bait bait N/A 328750 unspecified role unspecified role prey prey physical association physical association false false false bcl_2-nip3-1 Interaction between human Bcl-2 and Nip3 detected by Y2H 328745 N/A 328754 unspecified role unspecified role bait bait N/A 328751 unspecified role unspecified role prey prey physical association physical association false false false b5-e1b19k-2 Interaction between human B5 deletion mutant and adenovirus E1B19K detected by Y2H 328745 N/A 328753 unspecified role unspecified role prey prey N/A 328749 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false b5-b5-2 Homodimerisation of human B5 detected by Y2H 328745 N/A 328749 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 328749 unspecified role unspecified role prey prey physical association physical association false false false b5-nip3-2 Interaction between human B5 and Nip3 detected by Y2H 328745 N/A 328751 unspecified role unspecified role prey prey N/A 328749 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false b5-b5-3 Homodimerisation of human B5 detected by Y2H 328745 N/A 328749 unspecified role unspecified role prey prey N/A 328749 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis less-than less-than greater-than greater-than false physical association physical association false false false b5-nip3-3 Interaction between human B5 and Nip3 detected by Y2H 328745 N/A 328749 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis less-than less-than greater-than greater-than false N/A 328751 unspecified role unspecified role prey prey physical association physical association false false false b5-e1b19k-3 Interaction between human B5 and adenovirus E1B19K detected by Y2H 328745 N/A 328749 unspecified role unspecified role bait bait N/A 328753 unspecified role unspecified role prey prey undefined mutation D to Y mutation of aa 82 mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false e1b19k-lamin_a-1 Interaction between Adenovirus E1B19K protein and human Lamin A 328746 N/A 328753 unspecified role unspecified role bait bait N/A 328755 unspecified role unspecified role prey prey physical association physical association false false false e1b19k-lamin_c-1 Interaction between Adenovirus E1B19K protein and human Lamin C 328746 N/A 328752 unspecified role unspecified role prey prey N/A 328753 unspecified role unspecified role bait bait physical association physical association false false false e1b19k-bak-1 Interaction between Adenovirus E1B19K protein and human BAK 328746 N/A 328753 unspecified role unspecified role bait bait N/A 328756 unspecified role unspecified role prey prey physical association physical association false false false e1b19k-nip2-1 Interaction between Adenovirus E1B19K protein and human NIP2 328746 N/A 328750 unspecified role unspecified role prey prey N/A 328753 unspecified role unspecified role bait bait physical association physical association false false false e1b19k-nip3-1 Interaction between Adenovirus E1B19K protein and human NIP3 328746 N/A 328751 unspecified role unspecified role prey prey N/A 328753 unspecified role unspecified role bait bait physical association physical association false false false e1b19k-b5-1 Interaction between Adenovirus E1B19K protein and human B5 328746 N/A 328749 unspecified role unspecified role prey prey N/A 328753 unspecified role unspecified role bait bait physical association physical association false false false b5-b5-4 Homodimerisation of human B5 detected by beta-galactosidase assay 328747 N/A 328749 unspecified role unspecified role bait bait N/A 328749 unspecified role unspecified role prey prey physical association physical association false false false b5-nip3-4 Interaction between human B5 and Nip3 detected by beta-galactosidase assay 328747 N/A 328751 unspecified role unspecified role prey prey N/A 328749 unspecified role unspecified role bait bait physical association physical association false false false e1b19k-b5-2 Interaction between Adenovirus E1B19K protein and human B5 detected by beta-galactosidase assay 328747 N/A 328749 unspecified role unspecified role prey prey N/A 328753 unspecified role unspecified role bait bait physical association physical association false false false e1b19k-nip3-2 Interaction between Adenovirus E1B19K protein and human Nip3 detected by beta-galactosidase assay 328747 N/A 328751 unspecified role unspecified role prey prey N/A 328753 unspecified role unspecified role bait bait physical association physical association false false false b5-b5-5 Homodimerisation of human B5 detected by coIP 328748 N/A 328749 unspecified role unspecified role prey prey c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 328749 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false b5-b5-6 Homodimerisation of human B5 detected by coIP 328748 N/A 328749 unspecified role unspecified role prey prey c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 328749 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false b5-nip3-5 Interaction between human B5 and Nip3 detected by coIP 328748 N/A 328751 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 328749 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false nip3-nip3-1 Homodimerisation of human Nip3 detected by coIP 328748 N/A 328751 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 328751 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false