IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ dialynas-2006-1 Methylation-independent binding to histone H3 and cell cycle-dependent incorporation of HP1beta into heterochromatin. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dialynas GK., Makatsori D., Kourmouli N., Theodoropoulos PA., McLean K., Terjung S., Singh PB., Georgatos SD. Chromatin - Epigenetic interactions resulting in chromatin modulation sgeorgat@cc.uoi.gr J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology dialynas-2006-2 Methylation-independent binding to histone H3 and cell cycle-dependent incorporation of HP1beta into heterochromatin. in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Dialynas GK., Makatsori D., Kourmouli N., Theodoropoulos PA., McLean K., Terjung S., Singh PB., Georgatos SD. Chromatin - Epigenetic interactions resulting in chromatin modulation sgeorgat@cc.uoi.gr J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology h3_peptide_31-41 consensus H3 peptide AA 31- 41 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) STGGVKKPHRY An amino acid sequence which is not represented in UniProt Region of the peptide corresponding to the AA 31-41. Similar to P84244 Similar to P84243 cbx1_mouse Chromobox protein homolog 1 Cbx1 Cbx Heterochromatin protein 1 homolog beta Modifier 1 protein M31 Heterochromatin protein p25 protein protein mouse Mus musculus Mouse MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN h31_mouse Histone H3.1 H3c1 H3c10 H3c11 H3c8 H3.1-221 H3.1-291 H3.1-I H3a H3g H3h H3i Hist1h3a Hist1h3g Hist1h3h Hist1h3i protein protein mouse Mus musculus Mouse MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA cbx1-h3-2 510973 N/A 510975 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) N/A 510976 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1D Marginal binding observed. Cbx1_mouse was chosen as the interacting protein as indicated from authors previous studies. The CBX1 proteins share 100% identity between mouse and human. cbx1-h3-3 510973 N/A 510977 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 510976 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1A, B, C, D Strong binding observed even at a high ionic strength of 0.75 M NaCl. Interaction is independent of RNA or DNA. Cbx1_mouse was chosen as the interacting protein as indicated from authors previous studies. The CBX1 proteins share 100% identity between mouse and human. The source of recombinant H3 is not mentioned in the paper however 100% identity between the sequence in Fig1F and the following was observed: H3_ONCMY, H31_MOUSE, H32_MOUSE, H3_CHITH, H3_CAIMO , H32_BOVIN, H3_PORAF, H3_DROHY, H3_MORAP, H3_PLADU, H31_HUMAN, H3_TIGCA, H3_DROME, H3_URECA, H31_CHICK, H3_ICTBU, H31_BOVIN, Tail H3 peptide did not compete out this binding. cbx1-h3-4 510974 N/A 510977 unspecified role unspecified role prey prey histone fold sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 510976 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1E, F Cbx1_mouse was chosen as the interacting protein as indicated from authors previous studies. The CBX1 proteins share 100% identity between mouse and human. The source of recombinant H3 is not mentioned in the paper however 100% identity between the sequence in Fig 1F andthe following was observed: H3_ONCMY, H31_MOUSE, H32_MOUSE, H3_CHITH, H3_CAIMO , H32_BOVIN, H3_PORAF, H3_DROHY, H3_MORAP, H3_PLADU, H31_HUMAN, H3_TIGCA, H3_DROME, H3_URECA, H31_CHICK, H3_ICTBU, H31_BOVIN