IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hurtado_lor-2006-2 V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hurtado-Lorenzo A., Skinner M., El Annan J., Futai M., Sun-Wada GH., Bourgoin S., Casanova J., Wildeman A., Bechoua S., Ausiello DA., Brown D., Marshansky V. Synapse - Interactions of proteins with an established role in the presynapse. Vladmir_Marshansky@hms.harvard.edu Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology hurtado_lor-2006-1 V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway. mouse-prox_tubule_cell Mouse proximal tubule cells kidney-proximal_tubule Proximal Tubule cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hurtado-Lorenzo A., Skinner M., El Annan J., Futai M., Sun-Wada GH., Bourgoin S., Casanova J., Wildeman A., Bechoua S., Ausiello DA., Brown D., Marshansky V. Synapse - Interactions of proteins with an established role in the presynapse. Vladmir_Marshansky@hms.harvard.edu Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology hurtado_lor-2006-4 V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hurtado-Lorenzo A., Skinner M., El Annan J., Futai M., Sun-Wada GH., Bourgoin S., Casanova J., Wildeman A., Bechoua S., Ausiello DA., Brown D., Marshansky V. Synapse - Interactions of proteins with an established role in the presynapse. Vladmir_Marshansky@hms.harvard.edu Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology hurtado_lor-2006-5 V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hurtado-Lorenzo A., Skinner M., El Annan J., Futai M., Sun-Wada GH., Bourgoin S., Casanova J., Wildeman A., Bechoua S., Ausiello DA., Brown D., Marshansky V. Synapse - Interactions of proteins with an established role in the presynapse. Vladmir_Marshansky@hms.harvard.edu Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology hurtado_lor-2006-7 V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway. human-mtc Human medullary thyroid carcinoma mtc Human medullary thyroid carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hurtado-Lorenzo A., Skinner M., El Annan J., Futai M., Sun-Wada GH., Bourgoin S., Casanova J., Wildeman A., Bechoua S., Ausiello DA., Brown D., Marshansky V. Synapse - Interactions of proteins with an established role in the presynapse. Vladmir_Marshansky@hms.harvard.edu Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology hurtado_lor-2006-8 V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hurtado-Lorenzo A., Skinner M., El Annan J., Futai M., Sun-Wada GH., Bourgoin S., Casanova J., Wildeman A., Bechoua S., Ausiello DA., Brown D., Marshansky V. Synapse - Interactions of proteins with an established role in the presynapse. Vladmir_Marshansky@hms.harvard.edu Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology hurtado_lor-2006-3 V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hurtado-Lorenzo A., Skinner M., El Annan J., Futai M., Sun-Wada GH., Bourgoin S., Casanova J., Wildeman A., Bechoua S., Ausiello DA., Brown D., Marshansky V. Synapse - Interactions of proteins with an established role in the presynapse. Vladmir_Marshansky@hms.harvard.edu Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology hurtado_lor-2006-6 V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hurtado-Lorenzo A., Skinner M., El Annan J., Futai M., Sun-Wada GH., Bourgoin S., Casanova J., Wildeman A., Bechoua S., Ausiello DA., Brown D., Marshansky V. Synapse - Interactions of proteins with an established role in the presynapse. Vladmir_Marshansky@hms.harvard.edu Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology vpp2_mouse V-type proton ATPase 116 kDa subunit a2 Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2 Lysosomal H(+)-transporting ATPase V0 subunit a2 Immune suppressor factor J6B7 ShIF Atp6v0a2 Atp6n1b Tj6 protein protein mouse Mus musculus Mouse MGSLFRSESMCLAQLFLQSGTAYECLSALGEKGLVQFRDLNQNVSSFQRKFVGEVKRCEELERILVYLVQEITRADIPLPEGEASPPAPPLKHVLEMQEQLQKLEVELREVTKNKEKLRKNLLELVEYTHMLRVTKTFLKRNVEFEPTYEEFPALENDSLLDYSCMQRLGAKLGFVSGLIQQGRVEAFERMLWRACKGYTIVTYAELDECLEDPETGEVIKWYVFLISFWGEQIGHKVKKICDCYHCHIYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVCSRVVQVRKMKAIYHMLNMCSFDVTNKCLIAEVWCPEVDLPGLRRALEEGSRESGATIPSFMNTIPTKETPPTLIRTNKFTEGFQNIVDAYGVGSYREVNPALFTIITFPFLFAVMFGDFGHGFVMFLFALLLVLNENHPRLSQSQEILRMFFDGRYILLLMGLFSVYTGLIYNDCFSKSVNLFGSGWNVSAMYSSSHSPEEQRKMVLWNDSTIRHSRTLQLDPNIPGVFRGPYPFGIDPIWNLATNRLTFLNSFKMKMSVILGIFHMTFGVVLGIFNHLHFRKKFNVYLVSVPEILFMLCIFGYLIFMIIYKWLAYSAETSREAPSILIEFINMFLFPTSKTHGLYPGQAHVQRVLVALTVLAVPVLFLGKPLFLLWLHNGRNCFGMSRSGYTLVRKDSEEEVSLLGNQDIEEGNSRMEEGCREVTCEEFNFGEILMTQAIHSIEYCLGCISNTASYLRLWALSLAHAQLSDVLWAMLMRVGLRVDTTYGVLLLLPVMAFFAVLTIFILLVMEGLSAFLHAIRLHWVEFQNKFYVGAGTKFVPFSFSLLSSKFSNDDSIA cyh2_mouse Cytohesin-2 PH, SEC7 and coiled-coil domain-containing protein 2 SEC7 homolog B Pscd2 Cyth2 Sec7b ARF nucleotide-binding site opener protein protein mouse Mus musculus Mouse MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEDLLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP vatc1_mouse V-type proton ATPase subunit C 1 Vacuolar proton pump subunit C 1 Atp6v1c1 Atp6c Vatc Atp6c1 protein protein mouse Mus musculus Mouse MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK arf6_mouse ADP-ribosylation factor 6 Arf6 protein protein mouse Mus musculus Mouse MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS vpp2_human V-type proton ATPase 116 kDa subunit a2 Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2 Lysosomal H(+)-transporting ATPase V0 subunit a2 TJ6 ATP6V0A2 protein protein human Homo sapiens Human MGSLFRSETMCLAQLFLQSGTAYECLSALGEKGLVQFRDLNQNVSSFQRKFVGEVKRCEELERILVYLVQEINRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKNLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPSLESDSLLDYSCMQRLGAKLGFVSGLINQGKVEAFEKMLWRVCKGYTIVSYAELDESLEDPETGEVIKWYVFLISFWGEQIGHKVKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSRVIQVKKMKAIYHMLNMCSFDVTNKCLIAEVWCPEADLQDLRRALEEGSRESGATIPSFMNIIPTKETPPTRIRTNKFTEGFQNIVDAYGVGSYREVNPALFTIITFPFLFAVMFGDFGHGFVMFLFALLLVLNENHPRLNQSQEIMRMFFNGRYILLLMGLFSVYTGLIYNDCFSKSVNLFGSGWNVSAMYSSSHPPAEHKKMVLWNDSVVRHNSILQLDPSIPGVFRGPYPLGIDPIWNLATNRLTFLNSFKMKMSVILGIIHMTFGVILGIFNHLHFRKKFNIYLVSIPELLFMLCIFGYLIFMIFYKWLVFSAETSRVAPSILIEFINMFLFPASKTSGLYTGQEYVQRVLLVVTALSVPVLFLGKPLFLLWLHNGRSCFGVNRSGYTLIRKDSEEEVSLLGSQDIEEGNHQVEDGCREMACEEFNFGEILMTQVIHSIEYCLGCISNTASYLRLWALSLAHAQLSDVLWAMLMRVGLRVDTTYGVLLLLPVIALFAVLTIFILLIMEGLSAFLHAIRLHWVEFQNKFYVGAGTKFVPFSFSLLSSKFNNDDSVA cyh2_human Cytohesin-2 PH, SEC7 and coiled-coil domain-containing protein 2 ARF nucleotide-binding site opener ARF exchange factor CYTH2 ARNO PSCD2L PSCD2 protein protein human Homo sapiens Human MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP vatc1_human V-type proton ATPase subunit C 1 Vacuolar proton pump subunit C 1 ATP6V1C1 ATP6C ATP6D VATC protein protein human Homo sapiens Human MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS pscd2-atp6v0a2-2 Interaction between Pscd2 and Atp6v0a2 demonstrated by pulldown 504879 N/A 504887 unspecified role unspecified role prey prey mouse-prox_tubule_cell Mouse proximal tubule cells kidney-proximal_tubule Proximal Tubule cell N/A 504888 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 3B pscd2-atp6v0a2-3 Interaction between Pscd2 and Atp6v0a2 demonstrated by pulldown 504879 N/A 504888 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 504887 unspecified role unspecified role prey prey mouse-endosome Mouse endosome endosome Endosome A membrane-bound organelle that carries materials newly ingested by endocytosis. physical association physical association false false false 3C pscd2-atp6v0a2-4 Interaction between Pscd2 and Atp6v0a2 demonstrated by pulldown 504879 N/A 504887 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 504888 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3D & 3E pscd2-atp6v0a2-1 Interaction between Pscd2 and Atp6v0a2 demonstrated by coimmunoprecipitation 504880 N/A 504887 unspecified role unspecified role bait bait N/A 504888 unspecified role unspecified role prey prey physical association physical association false false false 3A, 3G, 4F Process is acidification dependent FCCP - an uncoupler of endosomal acidification arf6-atp6v1c1-3 Interaction between Arf6 and Atp6v1c1 demonstrated by coimmunoprecipitation 504880 N/A 504889 unspecified role unspecified role bait bait N/A 504890 unspecified role unspecified role prey prey physical association physical association false false false 3I & 3J pscd2-atp6v0a2-6 Interaction between Pscd2 and Atp6v0a2 demonstrated by coimmunoprecipitation 504881 N/A 504891 unspecified role unspecified role bait bait N/A 504892 unspecified role unspecified role prey prey physical association physical association false false false 3G arf6-atp6v1c1-2 Interaction between Arf6 and Atp6v1c1 demonstrated by coimmunoprecipitation 504881 N/A 504893 unspecified role unspecified role bait bait N/A 504894 unspecified role unspecified role prey prey physical association physical association false false false 3I & 3J pscd2-atp6v0a2-7 Interaction between Pscd2 and Atp6v0a2 demonstrated by coimmunoprecipitation 504882 N/A 504891 unspecified role unspecified role bait bait N/A 504892 unspecified role unspecified role prey prey physical association physical association false false false 3G arf6-atp6v1c1-4 Interaction between Arf6 and Atp6v1c1 demonstrated by coimmunoprecipitation 504882 N/A 504894 unspecified role unspecified role prey prey N/A 504893 unspecified role unspecified role bait bait physical association physical association false false false 3I & 3J arf6-atp6v1c1-5 Interaction between Arf6 and Atp6v1c1 demonstrated by coimmunoprecipitation 504883 N/A 504894 unspecified role unspecified role prey prey N/A 504893 unspecified role unspecified role bait bait hsv tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3I, 3J arf6-atp6v1c1-6 Interaction between Arf6 and Atp6v1c1 demonstrated by coimmunoprecipitation 504884 N/A 504894 unspecified role unspecified role prey prey N/A 504893 unspecified role unspecified role bait bait hsv tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3I, 3J pscd2-atp6v0a2-5 Interaction between Pscd2 and Atp6v0a2 demonstrated by mammalian 2-hybrid 504885 N/A 504888 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 504887 unspecified role unspecified role bait bait mouse-endosome Mouse endosome endosome Endosome A membrane-bound organelle that carries materials newly ingested by endocytosis. physical association physical association false false false 3F arf6-atp6v1c1-1 Interaction between Arf6 and Atp6v1c1 demonstrated by coimmunoprecipitation 504886 N/A 504890 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 504893 unspecified role unspecified role bait bait hsv tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3H