IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ toleman-2006-1 The histone acetyltransferase NCOAT contains a zinc finger-like motif involved in substrate recognition. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Toleman CA., Paterson AJ., Kudlow JE. BioCreative - Critical Assessment of Information Extraction systems in Biology 1 kudlow@uab.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation toleman-2006-2 The histone acetyltransferase NCOAT contains a zinc finger-like motif involved in substrate recognition. chlae-bsc40 Chlorocebus aethiops Grivet bsc40 Cerae kidney epithelial cells http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm?atccNum=CRL-2761 these cells are temperature tolerant pull down pull down western blot western blot Immuno blot Immuno blot Toleman CA., Paterson AJ., Kudlow JE. BioCreative - Critical Assessment of Information Extraction systems in Biology 1 kudlow@uab.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation oga_mouse Protein O-GlcNAcase Oga Beta-N-acetylhexosaminidase Beta-hexosaminidase Bifunctional protein NCOAT Hexc Kiaa0679 Meningioma-expressed antigen 5 Mgea5 N-acetyl-beta-D-glucosaminidase N-acetyl-beta-glucosaminidase protein protein mouse Mus musculus Mouse MVQKESQAALEERESERNANPAAASGASLEQSVAPAPGEDNPSGAGAAAVVGAAGGARRFLCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNMCAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEKLLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLENEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKTSVVDGTPLVAAPSLNATTVVTTVYQEPIMSQGAALSGEPSVLTKEEEKKQPDEEPMDMVVEKQEEAEHKNDNQILTEIVEAKMAEELRPMDTDKESMAESKSPEMSMQEDCIPDVAPMQTDEQTQKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKFEEMCALVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPYFPKDEASVYKICREMYDDGVGFPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYALGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFPKDVVILGRSL mint Cleaves GlcNAc but not GalNAc from glycopeptides. Can use p-nitrophenyl-beta-GlcNAc as substrate but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc. Possesses hyaluronidase activity (By similarity). Acetylates 'Lys-8' of histone H4 h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG ogt-h4 Interaction detected by pull down. 360536 N/A 360538 unspecified role unspecified role prey prey n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae-bsc40 Chlorocebus aethiops Grivet bsc40 Cerae kidney epithelial cells http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm?atccNum=CRL-2761 these cells are temperature tolerant N/A 360539 unspecified role unspecified role bait bait c terminal n6btnlys N6-biotinyl-L-lysine (2S)-2-amino-6-(5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoylamino)hexanoic acid (3aS-(3aalpha,4beta,6aalpha))-N6-(5-(hexahydro-2-oxo-1H-thieno(3,4-d)imidazol-4-yl)-1-oxopentyl)-L-lysine MOD_RES N6-biotinyllysine N6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]-L-lysine N6-biotinyl-L-lysine N6-biotinyllysine biocytin epsilon-N-biotinyllysine Biotin Biotinylation N6BtnLys biotinyl lysyl c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false The interaction was competed out by unlabelled H4 peptide. This interaction was also observed with nucleosomal histone H4. Acetylation of histone H4 tail abolishes this binding. hist1h4h-mgea5-1 Interaction detected by pull down. 360537 N/A 360538 unspecified role unspecified role prey prey n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9EQQ9:p.Tyr891Phe mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 360539 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The mutation on (NCOAT) OGT results in binding of unacetylated histone H4. This indicates that acetylation of histone H4 is not essential for binding however when NOAT is enzymaticaly active the histone is released on acetylation and hence not detected. Binding of inactive OGT (Tyr891Phe) is observed with both acetylated and unacetylated histone H4. The binding activity of OGT to nucleosomal histone H4 is dependent on Asp774, Phe789, Cys777 and Cys793