IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ leliveld-2006-1 The expanded octarepeat domain selectively binds prions and disrupts homomeric prion protein interactions. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Leliveld SR., Dame RT., Wuite GJ., Stitz L., Korth C. BioCreative - Critical Assessment of Information Extraction systems in Biology ckorth@uni-duesseldorf.de J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation leliveld-2006-3 The expanded octarepeat domain selectively binds prions and disrupts homomeric prion protein interactions. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Leliveld SR., Dame RT., Wuite GJ., Stitz L., Korth C. BioCreative - Critical Assessment of Information Extraction systems in Biology Complexes were fractionated on a HiPrep 16/60 Sephacryl S-200 HR column ckorth@uni-duesseldorf.de J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation leliveld-2006-4 The expanded octarepeat domain selectively binds prions and disrupts homomeric prion protein interactions. in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Leliveld SR., Dame RT., Wuite GJ., Stitz L., Korth C. BioCreative - Critical Assessment of Information Extraction systems in Biology GST�OR fusions were deposited on a freshly cleaved mica surface and images were acquired on a Nanoscope IIIa (Digital Instruments Inc.), operating in tapping mode in air with a type E scanner using silicon tips from Digital Instruments. ckorth@uni-duesseldorf.de J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation leliveld-2006-2 The expanded octarepeat domain selectively binds prions and disrupts homomeric prion protein interactions. in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Leliveld SR., Dame RT., Wuite GJ., Stitz L., Korth C. BioCreative - Critical Assessment of Information Extraction systems in Biology Dynamic light scattering (DLS) measurements were performed on a DynaPro-MS/X machine. peptides linked to BSA. ckorth@uni-duesseldorf.de J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation prio_mesau Major prion protein PrP27-30 PrP33-35C PRNP PRP protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster MANLSYWLLALFVAMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGTWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHNQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPMMHFGNDWEDRYYRENMNRYPNQVYYRPVDQYNNQNNFVHDCVNITIKQHTVTTTTKGENFTETDIKIMERVVEQMCTTQYQKESQAYYDGRRSSAVLFSSPPVILLISFLIFLMVG prion_or_construct Synthetic octarepeat contruct peptide peptide polypeptide oligopeptide oligopeptide polypeptide in vitro In vitro An amino acid sequence which is not represented in UniProt prnp-prnp-13 Self association of prion protein molecules via an octarepeat 504511 N/A 504515 unspecified role unspecified role prey prey mesau-brain Mesocricetus auratus brain brain Brain [cerebrum] N/A 504515 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 4or region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Paper describes prey construct as having 4 octarepeats between residues 52-98. UniProtKB entry contains 5. Interaction requires the presence of copper or zinc. A synthetic contruct containing 16 octarepeats (sequence not given) does not require a divalent metal ion to be present. 1 prnp-prnp-15 Self association of prion protein molecules via an octarepeat 504511 N/A 504515 unspecified role unspecified role prey prey mesau-brain Mesocricetus auratus brain brain Brain [cerebrum] N/A 504516 unspecified role unspecified role bait bait direct interaction direct interaction false false false A minimum octarepeat construct of 10 ORs was required to bind the pathological conformer of the prion protein. The interaction was inhibited by the addition of copper or zinc ions. Complex binding is resistant to SDS. 3 & 4 Scrapie prnp-prnp-16 Self association of prion protein molecules via an octarepeat 504512 N/A 504515 unspecified role unspecified role neutral component neutral component 4or region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Paper describes prey construct as having 4 octarepeats between residues 52-98. UniProtKB entry contains 5. Peptides form multimeric comlexes, interaction requires the presence of copper or zinc. Synthetic contructs containing 10-16 octarepeats (sequence not given) do not require a divalent metal ion to be present. 2B prnp-prnp-17 Self association of prion protein molecules via an octarepeat 504513 N/A 504515 unspecified role unspecified role neutral component neutral component 4or region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Paper describes prey construct as having 4 octarepeats between residues 52-98. UniProtKB entry contains 5. Peptides form multimeric comlexes, interaction requires the presence of copper or zinc. Synthetic contructs containing 10-16 octarepeats (sequence not given) do not require a divalent metal ion to be present. 2B prnp-prnp-14 Self association of prion protein molecules via an octarepeat 504514 N/A 504515 unspecified role unspecified role neutral component neutral component 4or region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Paper describes prey construct as having 4 octarepeats between residues 52-98. UniProtKB entry contains 5. Peptides form multimeric comlexes, interaction requires the presence of copper or zinc. Synthetic contructs containing 10-16 octarepeats (sequence not given) do not require a divalent metal ion to be present. Table 1