IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ choi-2006-4 Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology choi-2006-1 Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology choi-2006-2 Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology choi-2006-3 Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology cadh1_mouse Cadherin-1 Epithelial cadherin Uvomorulin ARC-1 Cdh1 protein protein mouse Mus musculus Mouse MGARCRSFSALLLLLQVSSWLCQELEPESCSPGFSSEVYTFPVPERHLERGHVLGRVRFEGCTGRPRTAFFSEDSRFKVATDGTITVKRHLKLHKLETSFLVRARDSSHRELSTKVTLKSMGHHHHRHHHRDPASESNPELLMFPSVYPGLRRQKRDWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDRESYPTYTLVVQAADLQGEGLSTTAKAVITVKDINDNAPVFNPSTYQGQVPENEVNARIATLKVTDDDAPNTPAWKAVYTVVNDPDQQFVVVTDPTTNDGILKTAKGLDFEAKQQYILHVRVENEEPFEGSLVPSTATVTVDVVDVNEAPIFMPAERRVEVPEDFGVGQEITSYTAREPDTFMDQKITYRIWRDTANWLEINPETGAIFTRAEMDREDAEHVKNSTYVALIIATDDGSPIATGTGTLLLVLLDVNDNAPIPEPRNMQFCQRNPQPHIITILDPDLPPNTSPFTAELTHGASVNWTIEYNDAAQESLILQPRKDLEIGEYKIHLKLADNQNKDQVTTLDVHVCDCEGTVNNCMKAGIVAAGLQVPAILGILGGILALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD ctnb1_mouse Catenin beta-1 Beta-catenin Ctnnb1 Catnb protein protein mouse Mus musculus Mouse MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL lef1_mouse Lymphoid enhancer-binding factor 1 Lef1 Lef-1 protein protein mouse Mus musculus Mouse MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGPSYSSYSGYIMMPNMNSDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPEIPTFYPLSPGGVGQITPPIGWQGQPVYPITGGFRQPYPSSLSGDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI cnbp1_human Beta-catenin-interacting protein 1 Inhibitor of beta-catenin and Tcf-4 CTNNBIP1 ICAT protein protein human Homo sapiens Human MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ apc_human Adenomatous polyposis coli protein APC DP2.5 Deleted in polyposis 2.5 protein protein human Homo sapiens Human MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQATEAERSSQNKHETGSHDAERQNEGQGVGEINMATSGNGQGSTTRMDHETASVLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTSQEDRSSGSTTELHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKRHVDQPIDYSLKYATDIPSSQKQSFSFSKSSSGQSSKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQPQKAATCKVSSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCNQTTQEADSANTLQIAEIKEKIGTRSAEDPVSEVPAVSQHPRTKSSRLQGSSLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTAQTKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQEKEAEKTIDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPSQNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRGGAQSGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLNAERVFSDNKDSKKQNLKNNSKVFNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTELTSNQQSANKTQAIAKQPINRGQPKPILQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENNNKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKGDNEKHSPRNMGGILGEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQANMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVKSELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASKGLNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDGRPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSISGTKQSKENQVSAKGTWRKIKENEFSPTNSTSQTVSSGATNGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKANPNIKDSKDNQAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTEIKPGQNNPVPVSETNESSIVERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV axin1_human Axin-1 Axis inhibition protein 1 AXIN1 AXIN protein protein human Homo sapiens Human MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD ctnnb1-cdh1-7 503930 N/A 503934 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 4 KD 8.3 (plus or minus 2.5) E-8 M DeltaH (kcal per mol) -39.5 plus or minus 0.2; TDeltaS (kcal per mol) -29.7 plus or minus 0.5; DeltaG (kcal/mol) -9.8 plus or minus 0.1 ctnnb1-cdh1-8 503930 N/A 503934 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 4 KD 9.3 (plus or minus 4.0) E-8 M DeltaH (kcal per mol) -39.7 plus or minus 0.5; TDeltaS (kcal per mol) -30.0 plus or minus 3.0; DeltaG (kcal/mol) -9.7 plus or minus 0.1 ctnnb1-cdh1-9 503930 N/A 503934 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 4 KD 1.13 (plus or minus 5.1) E-7 M DeltaH (kcal per mol) -43.3 plus or minus 0.4; TDeltaS (kcal per mol) -33.7; DeltaG (kcal/mol) -9.6 ctnnb1-cdh1-10 503930 N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503934 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 4 KD 6.0 (plus or minus 2.3) E-8 M DeltaH (kcal per mol) -34.8 plus or minus 0.2; TDeltaS (kcal per mol) -24.8; DeltaG (kcal/mol) -10.0 ctnnb1-lef1-2 503930 N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 503936 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-65) binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 5 Kd 5.0 (plus or minus 2.1) E-8 M DeltaH (kcal per M) -11.9 plus or minus 0.1; TDeltaS (kcal per mol) -1.8 plus or minus 0.2; DeltaG (kcal/mol) -10.1 plus or minus 0.1 ctnnb1-lef1-3 503930 N/A 503936 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-65) binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 5 KD 3.7 (plus or minus 1.7) E-8 M DeltaH (kcal per M) -16.1 plus or minus 0.1; TDeltaS (kcal per mol) -5.8; DeltaG (kcal/mol) -10.3 ctnnb1-lef1-4 503930 N/A 503936 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-65) binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 5 KD 2.8 (plus or minus 1.3) E-8 M DeltaH (kcal per M) -15.1 plus or minus 0.1; TDeltaS (kcal per mol) -4.6 plus or minus 1.0; DeltaG (kcal/mol) -10.5 plus or minus 0.1 ctnnb1-lef1-5 503930 N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503936 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-65) binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 5 KD 4.3 (plus or minus 2.4) E-8 M DeltaH (kcal per M) -10.5 plus or minus 0.1; TDeltaS (kcal per mol) -0.3 plus or minus 1.1; DeltaG (kcal/mol) -10.2 plus or minus 0.2 ctnnb1-ctnnbip1-2 503930 N/A 503937 unspecified role unspecified role neutral component neutral component n-terminal ICAT-h binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 6 KD 1.0 (plus or minus 2.0) E-8 M DeltaH (kcal per M) -11.5 plus or minus 0.1; TDeltaS (kcal per mol) -0.4; DeltaG (kcal/mol) -11.1 ctnnb1-ctnnbip1-3 503930 N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503937 unspecified role unspecified role neutral component neutral component n-terminal ICAT-h binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 6 KD 8.4 (plus or minus 6.2) E-8 M DeltaH (kcal per M) -10.2 plus or minus 0.1; TDeltaS (kcal per mol) -0.4; DeltaG (kcal/mol) -9.8 ctnnb1-ctnnbip1-4 503930 N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503937 unspecified role unspecified role neutral component neutral component n-terminal ICAT-h binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 6 KD 3.9 (plus or minus 2.3) E-8 M DeltaH (kcal per M) -8.1 plus or minus 0.1; TDeltaS (kcal per mol) 2.2; DeltaG (kcal/mol) -10.3 ctnnb1-ctnnbip1-5 503930 N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503937 unspecified role unspecified role neutral component neutral component n-terminal ICAT-h binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 6 KD 6.2 (plus or minus 4.6) E-8 M DeltaH (kcal per M) -10.8 plus or minus 0.1; TDeltaS (kcal per mol) -0.8; DeltaG (kcal/mol) -10.0 ctnnb1-apc-2 503930 N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 503938 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 7 KD 1.16 (plus or minus 0.7) E-5 M DeltaH (kcal per M) -9.3 plus or minus 0.4; TDeltaS (kcal per mol)-2.4 plus or minus 1.0; DeltaG (kcal/mol) -6.9 plus or minus 0.1 ctnnb1-apc-3 503930 N/A 503938 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 7 KD 1.0 (plus or minus 0.1) E-6 M DeltaH (kcal per M) -23.0 plus or minus 0.2; TDeltaS (kcal per mol) -14.6 plus or minus 0.2; DeltaG (kcal/mol) -8.4 plus or minus 0.1 ctnnb1-apc-4 503930 N/A 503935 unspecified role unspecified role neutral component neutral component n-terminal beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503938 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 7 KD 4.5 (plus or minus 0.1) E-6 M DeltaH (kcal per M) -19.3 plus or minus 0.4; TDeltaS (kcal per mol) -11.9; DeltaG (kcal/mol) -7.4 ctnnb1-apc-5 503930 N/A 503938 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component c-terminal beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 7 KD 1.45 (plus or minus 0.8) E-5 M DeltaH (kcal per M) -15.6 plus or minus 0.8; TDeltaS (kcal per mol) -8.9 plus or minus 0.3; DeltaG (kcal/mol) -6.7 plus or minus 0.2 ctnnb1-apc-6 503930 N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503938 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region PhosphoAPC-R3 (serines phosphorylated) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 7 KD 8.1 (plus or minus 4.9) E-8 M DeltaH (kcal per M) -25.9 plus or minus 0.1; TDeltaS (kcal per mol)-16.1; DeltaG (kcal/mol) -9.8 ctnnb1-axin1-1 503930 N/A 503939 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 8 KD 1.6 (plus or minus 0.1) E-6 M DeltaH (kcal per M) -9.0 plus or minus 0.2; TDeltaS (kcal per mol) -0.9 plus or minus 0.3; DeltaG (kcal/mol) -8.1 plus or minus 0.1 ctnnb1-axin1-2 503930 N/A 503935 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503939 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 8 KD 0.3 (plus or minus 0.4) E-6 M DeltaH (kcal per M) -12.0 plus or minus 0.2; TDeltaS (kcal per mol) -3.0; DeltaG (kcal/mol) -9.0 ctnnb1-axin1-3 503930 N/A 503939 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component n-terminal beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 8 KD 0.7 (plus or minus 0.1) E-6 M DeltaH (kcal per M) -9.7 plus or minus 0.3; TDeltaS (kcal per mol) -1.2; DeltaG (kcal/mol) -8.5 ctnnb1-axin1-4 503930 N/A 503939 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component c-terminal beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 8 KD 2.2 (plus or minus 0.1) E-6 M DeltaH (kcal per M) -10.2 plus or minus 0.3; TDeltaS (kcal per mol) -2.3; DeltaG (kcal/mol) -7.9 ctnnb1-cdh1 503931 N/A 503935 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 503934 unspecified role unspecified role bait bait region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 and Table 1 KD 3.6 (plus or minus 4.4) E-8 M DeltaH (kcal per M) -35.9 plus or minus 0.4; TDeltaS (kcal per mol) -25.6; DeltaG (kcal/mol) -10.3 ctnnb1-lef1 503931 N/A 503936 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-65) binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 and Table 1 KD 4.9 (plus or minus 3.6) E-8 M DeltaH (kcal per M) -14.7 plus or minus 0.1; TDeltaS (kcal per mol) -4.6; DeltaG (kcal/mol) -10.1 ctnnb1-lef1-1 503931 N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 503936 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-131) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 and Table 1 KD 2.0 (plus or minus 6.6) E-8 M DeltaH (kcal per M) -16.7 plus or minus 0.2; TDeltaS (kcal per mol) -6.0; DeltaG (kcal/mol) -10.7 ctnnb1-ctnnbip1 503931 N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 503937 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 and Table 1 Kd 3.1 (plus or minus 1.0) E-9 M DeltaH (kcal per M) -19.8 plus or minus 0.1; TDeltaS (kcal per mol) -8.0; DeltaG (kcal/mol) -11.8 ctnnb1-ctnnbip1-1 503931 N/A 503937 unspecified role unspecified role neutral component neutral component n-terminal ICAT-h sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 and Table 1 Kd 1.2 (plus or minus 1.0) E-8 M DeltaH (kcal per M) -12.5 plus or minus 0.1; TDeltaS (kcal per mol) -1.5; DeltaG (kcal/mol) -11.0 ctnnb1-apc 503931 N/A 503938 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 and Table 1 KD 3.1 (plus or minus 0.3) E-6 M DeltaH (kcal per M) -4.5 plus or minus 0.1; TDeltaS (kcal per mol) 3.1; DeltaG (kcal/mol) -7.6 ctnnb1-apc-1 503931 N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 503938 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region PhosphoAPC-R3 (serines phosphorylated) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 and Table 1 KD 1.0 (plus or minus 1.3) E-8 M DeltaH (kcal per M) -31.2 plus or minus 0.2; TDeltaS (kcal per mol) -20.1; DeltaG (kcal/mol) -11.1 ctnnb1-axin1 503931 N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 503939 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 and Table 1 KD 1.3 (plus or minus 0.2) E-6 M DeltaH (kcal per M) -6.9 plus or minus 0.2; TDeltaS (kcal per mol) 1.3; DeltaG (kcal/mol) -8.2 ctnnb1-cdh1-1 503932 N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 503934 unspecified role unspecified role neutral component neutral component region Phosphorylated cytoplasmic domain (serines phosphorylated) opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 and Table 1 KD 5.2 (plus or minus 5.0) E-11 M DeltaH (kcal per M) -53.5 plus or minus 1.6; TDeltaS (kcal per mol) -39.2; DeltaG (kcal/mol) -14.3 ctnnb1-cdh1-2 503932 N/A 503934 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 and Table 1 KD 4.6 (plus or minus 4.4) E-8 M; 4.6 (plus or minus 2.2) E-8 M in a second assay DeltaH (kcal per M) -39.2 plus or minus 0.2; TDeltaS (kcal per mol) -29.0; DeltaG (kcal/mol) -10.2 ctnnb1-cdh1-5 beta-cat-arm-Nt 503932 N/A 503934 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component n-terminal beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 4 KD 7.4 (plus or minus 3.8) E-8 M DeltaH (kcal per mol) -41.1 plus or minus 0.3; TDeltaS (kcal per mol) -31.2; DeltaG (kcal per mol) -9.9 ctnnb1-cdh1-6 beta-cat-arm-Ct 503932 N/A 503934 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role neutral component neutral component c-terminal beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 4 KD 5.8 (plus or minus 4.3) E-8 M DeltaH (kcal per mol) -36.5 plus or minus 0.6; TDeltaS (kcal per mol) -26.5; DeltaG (kcal per mol) -10.0 ctnnb1-cdh1-3 503933 N/A 503934 unspecified role unspecified role bait bait n-terminal biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 503935 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 5 A and C, Table 3 Fitting model 1:1 ka1 3.56 E5 per M per s; kd 6.49 E-3 per s; Fitting model heteroligand ka1 4.39 %5 per M per s; kd 5.15 E-3; ka2 1.11 E5 per s; kd2 1.41 E-2 per s. Fitting the data with simple 1:1 binding models (Table 3) gave KD values which are very close to the values obtained by ITC. The good agreement in the KD values indicates that although the 1:1 models do not give particularly good fits to the data (probably reflecting more complicated kinetic processes associated with the structuring of cadherin upon binding to beta-catenin), they are nonetheless reasonable approximations. The fitted rate constants show that phosphorylation increases the on rate approx. 13-fold and decreases the off rate approx. 18-fold. Better fits to the nonphosphorylated data were obtained using a model in which there are two distinct molecular species of E-cadherin on the chip (�heterogeneous ligand� model). ctnnb1-cdh1-4 503933 N/A 503935 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 503934 unspecified role unspecified role neutral component neutral component region Phosphorylated cytoplasmic domain (serines phosphorylated) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 5 B, Table 3 Fitting model 1:1 Ka1 4.49 E6 per M per s; kd 3.67 E-4 per s