IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ conner-2006-1 The second intracellular loop of the calcitonin gene-related peptide receptor provides molecular determinants for signal transduction and cell surface expression. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Conner AC., Simms J., Howitt SG., Wheatley M., Poyner DR. BioCreative - Critical Assessment of Information Extraction systems in Biology D.R.Poyner@aston.ac.uk J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation conner-2006-2 The second intracellular loop of the calcitonin gene-related peptide receptor provides molecular determinants for signal transduction and cell surface expression. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Conner AC., Simms J., Howitt SG., Wheatley M., Poyner DR. BioCreative - Critical Assessment of Information Extraction systems in Biology Membranes from cells transfected with HA-tagged CALCRL were homogenized briefly before use, and 500uL were incubated with 100 pM [125I]iodohistidyl8-human alpha CGRP. Presence of CALCRL confirmed by anti-HA Abs. D.R.Poyner@aston.ac.uk J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation ramp1_human Receptor activity-modifying protein 1 RAMP1 Calcitonin-receptor-like receptor activity-modifying protein 1 protein protein human Homo sapiens Human MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV calrl_human Calcitonin gene-related peptide type 1 receptor CALCRL CGRPR Calcitonin receptor-like receptor protein protein human Homo sapiens Human MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN p06881-pro_0000004054 Calcitonin gene-related peptide 1 CALCA CALC1 Alpha-type CGRP Calcitonin gene-related peptide I peptide peptide polypeptide oligopeptide oligopeptide polypeptide human Homo sapiens Human ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF 83 119 calcrl-ramp1-1 Colocalisation of CALCRL and RAMP1 493506 N/A 493508 unspecified role unspecified role neutral component neutral component N/A 493509 unspecified role unspecified role neutral component neutral component n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Species origin of RAMP1 clone assumed from previous work by this group. 3b calca-calcrl-1 Interaction between CALCRL and CALA demonstrated by competition binding 493507 N/A 493510 unspecified role unspecified role bait bait in vitro In vitro N/A 493509 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Addtional detail on alphaCGRP peptide taken from vendors catalogue Table 3, Fig. 4