IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ forbes-2006-1 An Arabidopsis Fip1 homolog interacts with RNA and provides conceptual links with a number of other polyadenylation factor subunits. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Forbes KP., Addepalli B., Hunt AG. BioCreative - Critical Assessment of Information Extraction systems in Biology Directed yeast two hybrid assay was used in this study. aghunt00@uky.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation forbes-2006-2 An Arabidopsis Fip1 homolog interacts with RNA and provides conceptual links with a number of other polyadenylation factor subunits. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Forbes KP., Addepalli B., Hunt AG. BioCreative - Critical Assessment of Information Extraction systems in Biology Directed yeast two hybrid assay was used in this study. aghunt00@uky.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation cpsf_arath 30-kDa cleavage and polyadenylation specificity factor 30 CPSF30 F26G16.6 Zinc finger CCCH domain-containing protein 11 F26G16.5 At1g30460 OXT6 Protein OXIDATIVE STRESS TOLERANT 6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEDADGLSFDFEGGLDSGPVQNTASVPVAPPENSSSAAVNVAPTYDHSSATVAGAGRGRSFRQTVCRHWLRGLCMKGDACGFLHQFDKARMPICRFFRLYGECREQDCVYKHTNEDIKECNMYKLGFCPNGPDCRYRHAKLPGPPPPVEEVLQKIQQLTTYNYGTNRLYQARNVAPQLQDRPQGQVPMQGQPQESGNLQQQQQQQPQQSQHQVSQTLIPNPADQTNRTSHPLPQGVNRYFVVKSNNRENFELSVQQGVWATQRSNEAKLNEAFDSVENVILIFSVNRTRHFQGCAKMTSRIGGYIGGGNWKHEHGTAQYGRNFSVKWLKLCELSFHKTRNLRNPYNENLPVKISRDCQELEPSVGEQLASLLYLEPDSELMAISIAAEAKREEEKAKGVNPESRAENPDIVPFEDNEEEEEEEDESEEEEESMAGGPQGRGRGRGIMWPPQMPLGRGIRPMPGMGGFPLGVMGPGDAFPYGPGGYNGMPDPFGMGPRPFGPYGPRFGGDFRGPVPGMMFPGRPPQQFPHGGYGMMGGGRGPHMGGMGNAPRGGRPMYYPPATSSARPGPSNRKTPERSDERGVSGDQQNQDASHDMEQFEVGNSLRNEESESEDEDEAPRRSRHGEGKKRR fips5_arath FIP1[V]-like protein FIPS5 FIP1[V] Factor interacting with poly(A) polymerase 1-like 5 Protein HOMOLOG OF YEAST FIP1 [V] At5g58040 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEDDEFGDLYSDVLQPFQPPVVLPPPPPLPHRSIDLNLRSQDQDVSEPNSAPISRVSDNDAVKLSTQDATRQAIVDGGGDDKDMSFDIEEPDADSTPTIPGLFVTGALPGLATDRGVSQVTTRIEQQVGGGGDGGYGGQGEGDDWDSDSEDDLQIVLNDSSRNVMIGGADRRSRMGDNEDDDDEDDEDPLVIVADTDPNQPMEEQMWGEDGLQGIEGDGKDGGEAGKGSGPGGATGPPKAGYSSHGYHPFHSQFKYVRPGAAPIPGGAASVGGPSSGQVRPPANLGPMAGRGRGDWRPLGMRNASAAQKGFHQPWGSNTAGRGLDFTLPSHKTIFEVDIDSFEEKPWRYPGVEMTDYFNFGLNEESWKDYCKQLDQHRIQTTMQSRIRVYESGRTDQGYDPDLPPELAAATGAQGVPVDSSNLVKPDSVQGDSAKVPANVRPTLPPGRPIPVETGSGERLPSIDTRAPRMRDLDAIIEIVCQDSHEDEPSGENGTDQADSSLPGENVPVETSYVNNKRPDTESAEHSPAQDEPHKNLLKKQDDEISRSTDSGQSFRSSSPVGDRGTRSSSVDREDVGGEAGKDAEMGEELKMSFTSPQSAVQEDDGGESKTERSSESSKARSGSHRDFQQEEDVIQDKHSSRPANNRKQYDNNAPHQSRKNQDRGKEMERTRAASKGGRENSNPHMELDSTYIYSIASREDFDKRKERDVDGAVWRRKEDDPYSRRGGDEGSRKRDREDDPGFRQRGKMRENEIRSKDDQVPSRKHMDDAGMRNIYEPDDHINKRRKDEEYLRRSRPEKNEISYGQRESMSRVKRERDDRLEHQKRDVQHKIRDDFDDHGSLRQRDDIYMQRDGNERLRERDVLDKLKLPHEDGISARGRERQVAVRGHRGSEDRSSRMKDEYKASDKEHVTKDTLRHAKQTKRRDYPGEESSSHHRGHEDFSARTDNIVNNEKKPRQERTGAKIDKFIDTLDGQRLQDRKHKDSRRKIKEQREGTESLSKQGEQNGSSVVTGSKGTNDARNCRSEIPHQPNTAKRHKENASSGDEIHDSKRGRTKLERWASHKEREDAVSAKSSSISSKLEEKENNTNGRLSEPVHGSIGKSRDVTEEKIGHDLADTKDGSEKGPGDRHLDTVEKLKKRSERFKLPMPTEKDTTGVKKMESETLPSAKIEGPVDSEGEYVWDERSCVRIGREYA cfis1_arath Pre-mRNA cleavage factor Im 25 kDa subunit 1 CFIS1 CFIM25 Cleavage and polyadenylation specificity factor 25 kDa subunit Cleavage and polyadenylation specificity factor subunit 25 F27B13.60 At4g29820 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGEEARALDMEEISDNTTRRNDVVHDLMVDLYPLSSYYFGSKEALRVKDEIISDRVIRLKSNYAAHGLRTCVEAVLLVELFKHPHVLLLQYRNSIFKLPGGRLRPGESDIEGLKRKLASKLSVNENVGVSGYEVGECIGMWWRPNFETLMYPFLPPNIKHPKECTKLFLVRLPVHQQFVVPKNFKLLAVPLCQLHENEKTYGPIMSQIPKLLSKFSFNMMEI pabn1_arath Polyadenylate-binding protein 1 PABN1 Nuclear poly(A)-binding protein 1 Poly(A)-binding protein I MWD22.6 At5g51120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPVHDEQEHEVYGGEIPEEEEGEMDTEEYEEHGGEEGAAAGDEELEPGSSSRDLEDMKKRIKEIEEEAGALREMQAKAEKDMGASQDPSGGVSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRGRPFRPMRGFMPGVPFYPPYAYGRVPRFRRPMRYRPY paps4_arath Nuclear poly(A) polymerase 4 PAPS4 NPAP Polynucleotide adenylyltransferase 4 T16I18.60 At4g32850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMVGTQNLGGSLPPLNSPKSYGITKPLSLAGPSSADIKRNVELEKYLVDEGLYESKDDTMRREEVLGRIDQIVKHWVKQLTQQRGYTDQMVEDANAVIFTFGSYRLGVHGPGADIDTLCVGPSYVNREEDFFIILHDILAEMEEVTELHPVPDAHVPVMKFKFQGIPIDLLYASISLLVVPQDLDISSSSVLCEVDEPTVRSLNGCRVADQILKLVPNFEHFRTTLRCLKYWAKKRGVYSNVTGFLGGVNWALLVARVCQLYPNAIPSMLVSRFFRVYTQWRWPNPVMLCAIEEDELGFPVWDRRKNHRDRYHLMPIITPAYPCMNSSYNVSQSTLRVMTEQFQFGNNILQEIELNKQHWSSLFEQYMFFEAYKNYLQVDIVAADAEDLLAWKGWVESRFRQLTLKIERDTNGMLMCHPQPNEYVDTARQFLHCAFFMGLQRAEGVGGQECQQFDIRGTVDEFRQEVNMYMFWKPGMDVFVSHVRRRQLPPFVFPNGYRRPRQSRHQNLPGGKSGEDGSVSHSGSVVERHAKRKNDSEMMDVRPEKPEKRASLSPQSLDIVSPENSAITTGWTPPVCNLRRPPSEEIEADNLNTECTELTDLARNECNSGSEQVLEVDSMAVVQECSDPAEPLGKCVTPDSVDVVACVSGQEENLDRNLRSVSISGTDSPLLPSRSCGQNRDYEGFGFPAANSDPMGKKNLYSQSGMSEDLQSNSLVSGMEKSEDRARSESFQKSQIRLLT fip1-cpsf30 Directed yeast-2-hybrid reveals interaction between Fip1 protein and the CPSF30 protein 493334 N/A 493336 unspecified role unspecified role prey prey N/A 493337 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2. fip1-cstf77 Directed yeast-2-hybrid reveals interaction between Fip1 protein and the CSTF77 protein 493334 N/A 493337 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 493337 unspecified role unspecified role prey prey physical association physical association false false false Table 2. fip1-cfim_25 Directed yeast-2-hybrid reveals interaction between Fip1 protein and the CFIm-25 protein 493334 N/A 493337 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 493338 unspecified role unspecified role prey prey physical association physical association false false false Table 2. fip1-pabn1 Directed yeast-2-hybrid reveals interaction between Fip1 protein and the PabN1 protein 493334 N/A 493337 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 493339 unspecified role unspecified role prey prey physical association physical association false false false Table 2. fip1-pap Directed yeast-2-hybrid reveals interaction between Fip1 protein and the PAP(IV) rotein 493334 N/A 493337 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 493340 unspecified role unspecified role prey prey physical association physical association false false false Table 2. fip1-pap-1 Pulldown assay reveals interaction between Fip1 protein and the PAP(IV) rotein 493335 N/A 493340 unspecified role unspecified role prey prey n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 493337 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3. fip1-cfim_25-1 Pulldown analysis reveals interaction between Fip1 protein and the CFIm-25 protein 493335 N/A 493338 unspecified role unspecified role bait bait c terminal cbp calcium binding protein tagged tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 493337 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 4. fip1-cpsf30-1 Pulldown analysis reveals interaction between Fip1 protein and the CPSF30 protein 493335 N/A 493336 unspecified role unspecified role bait bait n terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 493337 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 4. fip1-pabn1-1 Pulldown analysis reveals interaction between Fip1 protein and the PabN1 protein 493335 N/A 493337 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 493339 unspecified role unspecified role bait bait n terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 4. fip1-cstf77-1 Pulldown assay reveals interaction between Fip1 protein and the CSTF77 protein 493335 N/A 493337 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 493337 unspecified role unspecified role prey prey n terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 4.