IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ramsperger-2006-1 Crystal structure of an archaeal pentameric riboflavin synthase in complex with a substrate analog inhibitor: stereochemical implications. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ramsperger A., Augustin M., Schott AK., Gerhardt S., Krojer T., Eisenreich W., Illarionov B., Cushman M., Bacher A., Huber R., Fischer M. BioCreative - Critical Assessment of Information Extraction systems in Biology ramsperg@biochem.mpg.de,markus.fischer@ch.tum.de J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation ramsperg@biochem.mpg.de risc_metja Riboflavin synthase ribC MJ1184 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MTKKVGIVDTTFARVDMASIAIKKLKELSPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE ribc The protein ribC forms a pentamer 503145 N/A 503146 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 5.0 direct interaction direct interaction false false false The complex was desribed as a pentamer of size (approximate) 80X80X45 Angstrom. The binding substrate analog 6,7-dioxo-8-ribityllumazine (DORL) forms hydrogen bonds with the main chain gly41, Ile42, Glu97 and Asp44 of the active site of the protein. Hydrogen bonds are also observed between the O4 of DORL and His122 and O2 of DORL and Gln146. In the protein itself the Arg118 forms a salt bridge with Glu104. Figure 2C Table 1 The protein complex contained one pentamer in an asymetric unit. Poor electron density was determined in the C terminal region of three subunits of the pentamer (residues 143-153). The pentamer had a size of 80X80X45A. 2.3 A