IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ borzacchiel-2006-1 Bovine papillomavirus E5 oncoprotein binds to the activated form of the platelet-derived growth factor beta receptor in naturally occurring bovine urinary bladder tumours. bovin-urin_bladder_carcino Bos taurus urinary bladder carcinoma urinary_bladder_carcinoma urinary bladder carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Borzacchiello G., Russo V., Gentile F., Roperto F., Venuti A., Nitsch L., Campo MS., Roperto S. Cancer - Interactions investigated in the context of cancer borzacch@unina.it Oncogene (0950-9232) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology borzacchiel-2006-2 Bovine papillomavirus E5 oncoprotein binds to the activated form of the platelet-derived growth factor beta receptor in naturally occurring bovine urinary bladder tumours. bovin-urin_bladder_carcino Bos taurus urinary bladder carcinoma urinary_bladder_carcinoma urinary bladder carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Borzacchiello G., Russo V., Gentile F., Roperto F., Venuti A., Nitsch L., Campo MS., Roperto S. Cancer - Interactions investigated in the context of cancer borzacch@unina.it Oncogene (0950-9232) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology q6xhb4_bpv2 E5 protein protein bpv2 Bovine papillomavirus type 2 MPNLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF q0vc10_bovin PDGFRB protein protein bovin Bos taurus (Bovine) Bovine MWLPSAMQAVVLKGRVLLLPLLFLLGPQASWGLAIIPPGPELVLNLSSTFVLTCSGPAPVVWERMSQKPPQEMTETQDGTFSSVLTLVNVTGLDTGEYFCGYKRSHGLEASERKRLYIFVPDPSVGFLPVDPEELFIFLTEITETTIPCRVTDPRLVVMLHEKKVDVPLPIAYDPQRGFSGTFEDKTYICKTTIGDREVDSDAYHVYSLQGEPPFWPGAQPRQV q6xhb4-pdgfrb 506040 N/A 506042 unspecified role unspecified role bait bait N/A 506043 unspecified role unspecified role prey prey region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 A, 4 B Three different BPV-2-positive bovine bladder cancer samples were tested. q6xhb4-pdgfrb-1 506040 N/A 506043 unspecified role unspecified role bait bait N/A 506042 unspecified role unspecified role prey prey physical association physical association false false false 3 B Three different BPV-2-positive bovine bladder cancer samples were tested. q6xhb4-pdgfrb-2 506041 N/A 506043 unspecified role unspecified role neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 506042 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2 m-o