IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ eloranta-1998-1 In vitro assembly of an archaeal D-L-N RNA polymerase subunit complex reveals a eukaryote-like structural arrangement. methanocaldococcus jannaschii Methanocaldococcus jannaschii Methanococcus jannaschii 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Eloranta JJ., Kato A., Teng MS., Weinzierl RO. Archaea - Interaction dataset based on Archaea proteins r.wienzierl@ic.ac.uk Nucleic Acids Res. (0305-1048) 1998 Only protein-protein interactions imex curation eloranta-1998-2 In vitro assembly of an archaeal D-L-N RNA polymerase subunit complex reveals a eukaryote-like structural arrangement. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Eloranta JJ., Kato A., Teng MS., Weinzierl RO. Archaea - Interaction dataset based on Archaea proteins Subunits initially purifeid by pulldown, with GST-RPAD as bait. GST tag cleaved off, and complex further purified by size exclusion chromatography on a Sephacryl S-100 column. r.wienzierl@ic.ac.uk Nucleic Acids Res. (0305-1048) 1998 Only protein-protein interactions imex curation rpo3_metja DNA-directed RNA polymerase subunit Rpo3 rpo3 DNA-directed RNA polymerase subunit D rpoD MJ0192 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MITIKEKRKTRIGEEFIFSLKAPISFSNAIRRIMISEVPTFAIEDVYIYENSSSMDDEILAHRLGLIPIKGKPLLENEVITFTLEKEGPCTVYSSDLKSENGEVAFKNIPIVKLGKGQRIQIECEAIPGIGKVHAKWQPCNAVYKQIADDEVEFFVETFGQMEAEEILEEAVKILKNKAESFLQQLEMIEQ rpo11_metja DNA-directed RNA polymerase subunit Rpo11 rpo11 DNA-directed RNA polymerase subunit L rpoL MJ0387 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MEIKILERKDNLVEIELINEDHSLPNLLKDILLTKEGVKMASYSIDHPLLHPETGRYISNPKITIITEEGTDPLEVLKEGLRDIIKMCDTLLDELKEKK rpb11_yeast DNA-directed RNA polymerase II subunit RPB11 YOL005C RPB11 DNA-directed RNA polymerase II 13.6 kDa polypeptide B13.6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF A98D109C5FF8E356 rpac2_yeast DNA-directed RNA polymerases I and III subunit RPAC2 YNL113W N1937 RPC19 DNA-directed RNA polymerases I and III 16 kDa polypeptide RPA19 AC19 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM 0B048299A787EEDB rpod-rpol Association between rpoD and rpoL in a yeast two hybrid assay 876032 n/a 876034 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 876035 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 2 rpol-rpod Association between rpoL and rpoD in a yeast two hybrid assay 876032 n/a 876034 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 876035 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 2 rpod-rbp11 Association between rpoD and RBP11 in a yeast two hybrid assay 876032 n/a 876034 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 876036 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 4 rbp11-rpod Association between RBP11 and rpod in a yeast two hybrid assay 876032 n/a 876034 unspecified role unspecified role prey prey n/a 876036 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 rpod-rpac2 Association between rpoD and RPC19 in a yeast two hybrid assay 876032 n/a 876034 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 876037 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 rpod-rpac2-1 Association between rpoD and RPC19 in a yeast two hybrid assay 876032 n/a 876034 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 876037 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 rpod 876033 n/a 876034 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 876035 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3, 5 and 6