IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ parida-2005-1 Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. myctx Mycobacterium tuberculosis 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Parida BK., Douglas T., Nino C., Dhandayuthapani S. Archaea - Interaction dataset based on Archaea proteins The interactions between the proteins were determined by positive growth of yeast in SD plates lacking adenine and histidine and the presence of blue color for α-galactosidase activity. Colonies which did not show blue in SD plates were not considered positive. The α-galactosidase activity was graded as weak (+), strong (++) and very strong (+++) based on the intensity of the blue color of the yeast colonies. dhandayutha@uthscsa.edu Tuberculosis (Edinb) (1472-9792) 2005 Only protein-protein interactions imex curation mtdrp_myctu Multidomain regulatory protein Rv1364c Anti-sigma-F factor Rv1364c Protein-serine/threonine phosphatase Putative multidomain regulator of SigF Serine/threonine-protein kinase MTCY02B10.28c Rv1364c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAAEMDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQTDYDGSGVEERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQAAEARVEELSERYRNVRDSATVMQQALLAASVPVVPGADIAAEYLVAAEDTAAGGDWFDALALGDRLVLVVGDVVGHGVEAAAVMSQLRTALRMQISAGYTVVEALEAVDRFHKQVPGSKSATMCVGSLDFTSGEFQYCTAGHPPPLLVTADASARYVEPTGAGPLGSGTGFPVRSEVLNIGDAILFYTDGLIERPGRPLEASTAEFADLAASIASGSGGFVLDAPARPIDRLCSDTLELLLRSTGYNDDVTLLAMQRRAPTPPLHITLDATINAARTVRAQLREWLAEIGADHSDIADIVHAISEFVENAVEHGYATDVSKGIVVAAALAGDGNVRASVIDRGQWKDHRDGARGRGRGLAMAEALVSEARIMHGAGGTTATLTHRLSRPARFVTDTMVRRAAFQQTIDSEFVSLVESGRIVVRGDVDSTTAATLDRQIAVESRSGIAPVTIDLSAVTHLGSAGVGALAAACDRARKQGTECVLVAPPGSPAHHVLSLVQLPVVGADTEDIFAQE 51F29AA39D9C8B9F rsfa_myctu Anti-sigma-F factor antagonist RsfA rsfA Anti-anti-sigma F factor RsfA MTCY02B10.29c Rv1365c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEPLVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDRAVARIIHACGYGDVLPVHPTTESALSAT o07728_myctu Anti-sigma factor antagonist Rv1904 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MRTVAIGPGAGPSSTRPSSQPSDLHSGLRAVTECTGSAVVVHVGGDIDASNEVAWQRLVSKSAAIAIAPGPFVIDIRDLDFMGSCAYAVLAQESVRCRRRGVNMRLVSNQPIVARTIAACGLRRLIPLYATVETALAPPPSAH p71937_mycto Anti-sigma factor antagonist MT2716 protein protein mycto Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) MGLITTEPRSSPHPLSPRLVHELGDPHSTLRATTDGSGAALLIHAGGEIDGRNEHLWRQLVTEAAAGVTAPGPLIVDVTGLDFMGCCAFAALADEAQRCRCRGIDLRLVSHQPIVARIAEAGGLSRVLPIYPTVDTALGKGTAGPARC rsbw_myctu Anti-sigma-F factor RsbW rsbW Anti-sigma-F factor UsfX Regulator of SigF Sigma-F anti-sigma factor RsbW usfX Rv3287c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTDQLEDQTQGGSTVDRSLPGGCMADSDLPTKGRQRGVRAVELNVAARLENLALLRTLVGAIGTFEDLDFDAVADLRLAVDEVCTRLIRSALPDATLRLVVDPRKDEVVVEASAACDTHDVVAPGSFSWHVLTALADDVQTFHDGRQPDVAGSVFGITLTARRAASSR opra_myctu Osmosensory protein A OprA Putative SigF antagonist Putative anti-anti-sigma factor Rv0516c Rv0516c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTTTIPTSKSACSVTTRPGNAAVDYGGAQIRAYLHHLATVVTIRGEIDAANVEQISEHVRRFSLGTNPMVLDLSELSHFSGAGISLLCILDEDCRAAGVQWALVASPAVVEQLGGRCDQGEHESMFPMARSVHKALHDLADAIDRRRQLVLPLISRSA sigf_myctu RNA polymerase sigma factor SigF sigF Alternative RNA polymerase sigma factor SigF RNA polymerase sigma-F factor Stress response/stationary phase sigma factor SigF Rv3286c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPLADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQIENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGISQMHVSRLLAKSLARLRDQLE rsfb_myctu Anti-sigma-F factor antagonist RsfB rsfB Anti-anti-sigma F factor RsfB Rv3687c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSAPDSITVTVADHNGVAVLSIGGEIDLITAAALEEAIGEVVADNPTALVIDLSAVEFLGSVGLKILAATSEKIGQSVKFGVVARGSVTRRPIHLMGLDKTFRLFSTLHDALTGVRGGRIDR rv1364-rv1365-1 883721 n/a 883722 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 883723 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + Table 3 + rv1904-rv1364-1 883721 n/a 883724 unspecified role unspecified role bait bait n/a 883722 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3 ++ rv1904-rv1365-1 883721 n/a 883723 unspecified role unspecified role prey prey n/a 883724 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv2638-rv1365-1 883721 n/a 883723 unspecified role unspecified role prey prey n/a 883725 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv1365-rv1904-1 883721 n/a 883723 unspecified role unspecified role bait bait n/a 883724 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv1904-rv1904-1 883721 n/a 883724 unspecified role unspecified role prey prey n/a 883724 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + Table 3 + rv3287-rv1904-1 883721 n/a 883726 unspecified role unspecified role bait bait n/a 883724 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv0516-rv2638-1 883721 n/a 883725 unspecified role unspecified role prey prey n/a 883727 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv1364-rv2638-1 883721 n/a 883722 unspecified role unspecified role bait bait n/a 883725 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv1365-rv2638-1 883721 n/a 883725 unspecified role unspecified role prey prey n/a 883723 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv2638-rv2638-1 883721 n/a 883725 unspecified role unspecified role prey prey n/a 883725 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv3286-rv2638-1 883721 n/a 883725 unspecified role unspecified role prey prey n/a 883728 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv3287-rv2638-1 883721 n/a 883726 unspecified role unspecified role bait bait n/a 883725 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv0516-rv3286-1 883721 n/a 883727 unspecified role unspecified role bait bait n/a 883728 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3 ++ rv1364-rv3286-1 883721 n/a 883728 unspecified role unspecified role prey prey n/a 883722 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 The RpsU and RpsV domains were sufficient to bind to SigF protein but these could not be matched to any identified InterPro domains and details of the constructs were not given in the paper. +++ rv1904-rv3286-1 883721 n/a 883724 unspecified role unspecified role bait bait n/a 883728 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3 ++ rv2638-rv3286-1 883721 n/a 883728 unspecified role unspecified role prey prey n/a 883725 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3 ++ rv3286-rv3286-1 883721 n/a 883728 unspecified role unspecified role bait bait n/a 883728 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv3287-rv3286-1 883721 n/a 883728 unspecified role unspecified role prey prey n/a 883726 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. +++ Table 3 +++ rv-1364-rv3287-1 883721 n/a 883722 unspecified role unspecified role bait bait n/a 883726 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3 ++ rv1365-rv3287-1 883721 n/a 883726 unspecified role unspecified role prey prey n/a 883723 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3, Table 4 ++ rv1904-rv3287-1 883721 n/a 883726 unspecified role unspecified role prey prey n/a 883724 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3 ++ rv2638-rv3287-1 883721 n/a 883725 unspecified role unspecified role bait bait n/a 883726 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3 ++ rv3286-rv3287-1 883721 n/a 883726 unspecified role unspecified role prey prey n/a 883728 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3 ++ rv3287-rv3287-1 883721 n/a 883726 unspecified role unspecified role prey prey n/a 883726 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3 ++ rv3687-rv3287-1 883721 n/a 883729 unspecified role unspecified role bait bait P9WGE1:p.Ser61Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 883726 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. ++ Table 3, Table 4 ++ rv1364-rv1364-1 883721 n/a 883722 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 883722 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pas domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false 883816 883813 physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. + Table 5 The RsbU and RsbW domains of Q11034 interacted with each other but these domains could not be matched to identified domains within InterPro and construct details were not given in the publication. +