IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kifusa-2005-1 Protein-protein interactions in the subunits of ribonuclease P in the hyperthermophilic archaeon Pyrococcus horikoshii OT3. pyrho Pyrococcus horikoshii 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kifusa M., Fukuhara H., Hayashi T., Kimura M. Archaea - Interaction dataset based on Archaea proteins mkifusa@agr.kyushu-u.ac.jp Biosci. Biotechnol. Biochem. (0916-8451) 2005 Only protein-protein interactions imex curation kifusa-2005-2 Protein-protein interactions in the subunits of ribonuclease P in the hyperthermophilic archaeon Pyrococcus horikoshii OT3. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kifusa M., Fukuhara H., Hayashi T., Kimura M. Archaea - Interaction dataset based on Archaea proteins mkifusa@agr.kyushu-u.ac.jp Biosci. Biotechnol. Biochem. (0916-8451) 2005 Only protein-protein interactions imex curation rnp2_pyrho Ribonuclease P protein component 2 rnp2 Pop5 PH1481 protein protein pyrho Pyrococcus horikoshii MMRKLKTLPPTLRDKNRYIAFEIISDGDFTKDEVKELIWKSSLEVLGETGTAIVKPWLIKFDPNTKTGIVRCDREYVEYLRFALMLVSEFNGKRLIIRTLGVSGTIKRLKRKFLAKYGWK rnp3_pyrho Ribonuclease P protein component 3 rnp3 Rpp30 PH1877 protein protein pyrho Pyrococcus horikoshii MVGGGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVIGMEIPQAKASISMYPEIILKRLKY rnp1_pyrho Ribonuclease P protein component 1 rnp1 Rpp29 PH1771 protein protein pyrho Pyrococcus horikoshii MRRNSKERKNRATRRSQGSYQEIIGRTWIFRGAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVCIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW rnp4_pyrho Ribonuclease P protein component 4 Rpp21 PH1601 rnp4 protein protein pyrho Pyrococcus horikoshii MVDIVKRRDWEKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPYLREVKQKRKKAT rnp2-rnp2 Self-interaction of Rnp2 in a yeast two-hybrid experiment 884089 n/a 884091 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 884091 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 1 rnp3-rnp3 Self-interaction of Rnp3 in a yeast two-hybrid experiment 884089 n/a 884092 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 884092 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 1 rnp1-rnp1 Self-interaction of Rnp1 in a yeast two-hybrid interaction 884089 n/a 884093 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 884093 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 1 rnp2-rnp4-1 884089 n/a 884094 unspecified role unspecified role prey prey n/a 884091 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 1 rnp2-rnp3 884089 n/a 884091 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 884092 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1 rnp4-rnp2 884089 n/a 884094 unspecified role unspecified role bait bait n/a 884091 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 1 rnp4-rnp1 884089 n/a 884094 unspecified role unspecified role bait bait n/a 884093 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1 rnp1-rnp4 884089 n/a 884093 unspecified role unspecified role bait bait n/a 884094 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1 rnp4-rnp2-1 884090 n/a 884091 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 884094 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2 rnp3-rnp2-1 884090 n/a 884091 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 884092 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2