IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hall-2004-1 Interactions between RNase P protein subunits in archaea. metth Methanobacterium thermoautotrophicum Methanobacterium thermoautotrophicum 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hall TA., Brown JW. Archaea - Interaction dataset based on Archaea proteins james_brown@ncsu.edu Archaea (1472-3646) 2004 Only protein-protein interactions imex curation rnp2_metth Ribonuclease P protein component 2 rnp2 Pop5 MTH_687 protein protein metth Methanobacterium thermoautotrophicum Methanobacterium thermoautotrophicum MKILPPTLRVPRRYIAFEVISERELSREELVSLIWDSCLKLHGECETSNFRLWLMKLWRFDFPDAVRVRGILQCQRGYERRVMMALTCAHHHSGVRVAIHILGLSGTIRSATQKFIKPSKKDKY rnp3_metth Ribonuclease P protein component 3 rnp3 Rpp30 MTH_688 protein protein metth Methanobacterium thermoautotrophicum Methanobacterium thermoautotrophicum MIPQRILMKFFDFHIQGRDHDSSLRLLLEASRLGYQGGVLVYPSERYPDLKSDLESLRENPELQDFEIARGVMINASDPRDMRRSVNKFRKKADVIYVSGGNLKVNRAACESRRVDVLSAPYTSRRDPGINHVLAREAARNNVAVELPLADVIGSWLKVRARVLEQFREILKLHRKFGFPLLLTSRASSIYDLRTPGDIMNLAECFGMESSEAEESLTSTPASILEDSGNRHLLIAEGVRLLPES rnp1_metth Ribonuclease P protein component 1 rnp1 Rpp29 MTH_11 protein protein metth Methanobacterium thermoautotrophicum Methanobacterium thermoautotrophicum MITPRNIFRHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGREITVPKGIAVFHFRTPQGELVEIDGRALVARPEERIKKKFRKP rnp4_metth Ribonuclease P protein component 4 rnp4 Rpp21 MTH_1618 protein protein metth Methanobacterium thermoautotrophicum Methanobacterium thermoautotrophicum MRRGKRPRWMLKIAEERIDILFRMADREFSANPHRSHRYTELARNIAMKYRVRIPREWRRRFCRKCYSFLKPGANCTVRIADGKVNFRCHECGHIMRFPYIREKKDRRRNKIESHTTKEGTDEQITVGAHNKCGESQSDR mp3-mp2 Association between mp3 (Mth688p) and mp2 (Mth687p) in a yeast two-hybrid assay 872144 n/a 872145 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 872146 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false The pACT2-MTH688/pLexA-MTH687 interaction was stronger than the pACT2-MTH687/pLexA-MTH688 interaction. Figs. 3and 4 mp2-mp3 Association between mp2 (Mth687p) and mp3 (Mth688p) in a yeast two-hybrid assay 872144 n/a 872146 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 872145 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false The pACT2-MTH688/pLexA-MTH687 interaction was stronger than the pACT2-MTH687/pLexA-MTH688 interaction. Figs. 3 B and 4 B mp4-mp1 Association between mp4 (Mth1618p) and mp1 (Mth11p) in a yeast two-hybrid assay 872144 n/a 872147 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 872148 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false The pACT2-MTH1618/pLexA-MTH11 interaction was stronger than the pACT2-MTH11/pLexA-MTH1618 interaction. Figs. 3 A and 4 A mp1-mp4 Association between mp4 (Mth1618p) and mp1 (Mth11p) in a yeast two-hybrid assay 872144 n/a 872148 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 872147 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false The pACT2-MTH1618/pLexA-MTH11 interaction was stronger than the pACT2-MTH11/pLexA-MTH1618 interaction. Figs. 3 A and 4 A