IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ nemeth-1998-1 Pleiotropic control of glucose and hormone responses by PRL1, a nuclear WD protein, in Arabidopsis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Nemeth K., Salchert K., Putnoky P., Bhalerao R., Koncz-Kalman Z., Stankovic-Stangeland B., Bako L., Mathur J., Okresz L., Stabel S., Geigenberger P., Stitt M., Redei GP., Schell J., Koncz C. Apoptosis - Interactions involving proteins with a function related to apoptosis koncz@mpiz-koeln.mpg.de Genes Dev. (0890-9369) 1998 Only protein-protein interactions imex curation nemeth-1998-2 Pleiotropic control of glucose and hormone responses by PRL1, a nuclear WD protein, in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nemeth K., Salchert K., Putnoky P., Bhalerao R., Koncz-Kalman Z., Stankovic-Stangeland B., Bako L., Mathur J., Okresz L., Stabel S., Geigenberger P., Stitt M., Redei GP., Schell J., Koncz C. Apoptosis - Interactions involving proteins with a function related to apoptosis koncz@mpiz-koeln.mpg.de Arabidopsis cell suspension cDNA library. Genes Dev. (0890-9369) 1998 Only protein-protein interactions imex curation nemeth-1998-3 Pleiotropic control of glucose and hormone responses by PRL1, a nuclear WD protein, in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nemeth K., Salchert K., Putnoky P., Bhalerao R., Koncz-Kalman Z., Stankovic-Stangeland B., Bako L., Mathur J., Okresz L., Stabel S., Geigenberger P., Stitt M., Redei GP., Schell J., Koncz C. Apoptosis - Interactions involving proteins with a function related to apoptosis koncz@mpiz-koeln.mpg.de Genes Dev. (0890-9369) 1998 Only protein-protein interactions imex curation nemeth-1998-4 Pleiotropic control of glucose and hormone responses by PRL1, a nuclear WD protein, in Arabidopsis. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Nemeth K., Salchert K., Putnoky P., Bhalerao R., Koncz-Kalman Z., Stankovic-Stangeland B., Bako L., Mathur J., Okresz L., Stabel S., Geigenberger P., Stitt M., Redei GP., Schell J., Koncz C. Apoptosis - Interactions involving proteins with a function related to apoptosis koncz@mpiz-koeln.mpg.de Genes Dev. (0890-9369) 1998 Only protein-protein interactions imex curation kpcb_human Protein kinase C beta type PRKCB1 PKCB PRKCB protein protein human Homo sapiens Human MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV prl1_arath Protein pleiotropic regulatory locus 1 PRL1 At4g15900 dl3990w MAC2 MOS4-associated complex protein 2 FCAALL.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPAPTTEIEPIEAQSLKKLSLKSLKRSLELFSPVHGQFPPPDPEAKQIRLSHKMKVAFGGVEPVVSQPPRQPDRINEQPGPSNALSLAAPEGSKSTQKGATESAIVVGPTLLRPILPKGLNYTGSSGKSTTIIPANVSSYQRNLSTAALMERIPSRWPRPEWHAPWKNYRVIQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTGHIEQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRVWDIRTKMQIFALSGHDNTVCSVFTRPTDPQVVTGSHDTTIKFWDLRYGKTMSTLTHHKKSVRAMTLHPKENAFASASADNTKKFSLPKGEFCHNMLSQQKTIINAMAVNEDGVMVTGGDNGSIWFWDWKSGHSFQQSETIVQPGSLESEAGIYAACYDNTGSRLVTCEADKTIKMWKEDENATPETHPINFKPPKEIRRF impa3_arath Importin subunit alpha-3 IMPA3 KAP2 Karyopherin subunit alpha-2 MOS6 Protein MODIFIER OF SNC1 6 T10M13.16 At4g02150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLRPSAKTEVRRNRYKVAVDAEEGRRRREDNLVEIRKNKREENLQKKRFTSSMAFGSATGQTEQDLSSANQLKDNLPAMVAGIWSEDSNSQLEATNLLRKLLSIEQNPPINEVVQSGVVPRVVKFLSRDDFPKLQFEAAWALTNIASGTSENTNVIIESGAVPIFIQLLSSASEDVREQAVWALGNVAGDSPKCRDLVLSYGAMTPLLSQFNENTKLSMLRNATWTLSNFCRGKPPPAFEQTQPALPVLERLVQSMDEEVLTDACWALSYLSDNSNDKIQAVIEAGVVPRLIQLLGHSSPSVLIPALRTIGNIVTGDDLQTQMVLDQQALPCLLNLLKNNYKKSIKKEACWTISNITAGNADQIQAVIDAGIIQSLVWVLQSAEFEVKKEAAWGISNATSGGTHDQIKFMVSQGCIKPLCDLLTCPDLKVVTVCLEALENILVVGEAEKNLGHTGEDNLYAQMIDEAEGLEKIENLQSHDNNDIYDKAVKILETFWTEDNEEEGNDENHAPQSGFQFGSTNVPPGQFNFI prl1-pkcb Interaction between Arabidopsis PRL1 and Human Protein kinase C beta type protein 728494 N/A 728498 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. N/A 728499 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 4e The authors stated that "Because PKC-beta I and beta II sequences only differed by 52 carboxy-terminal amino acids (Kubo et al. 1987), the data also indicated that the carboxyl terminus of PKC-beta II was required for PRL1-binding". The expressed in annotation for the P05771 protein is spofr-sf_21, although the authors only state the protein was expressed in an insect based protein expression system. I have assumed this is based on the spofr-sf_21 cell expression system. prl1-kap2 Interaction between PRL1 and KAP2 728495 N/A 728500 unspecified role unspecified role prey prey N/A 728499 unspecified role unspecified role bait bait physical association physical association false false false prl1-kap2-1 Interaction between PRL1 and KAP2 728496 N/A 728500 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 728499 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 7b prl1-kap2-2 Interaction between PRL1 and KAP2 728497 N/A 728499 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 728500 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 7c