IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ conradt-1998-2 The C. elegans protein EGL-1 is required for programmed cell death and interacts with the Bcl-2-like protein CED-9. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Conradt B., Horvitz HR. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell (0092-8674) 1998 conradt-1998-1 The C. elegans protein EGL-1 is required for programmed cell death and interacts with the Bcl-2-like protein CED-9. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Conradt B., Horvitz HR. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell (0092-8674) 1998 egl1_caeel Programmed cell death activator egl-1 Egg-laying defective protein 1 egl-1 F23B12.9 protein protein caeel Caenorhabditis elegans MLMLTFASTSSDLLPMSNVFDVQSSVFYNEKNMFYSSSQDFSSCEDSSQFADDSGFFDDSEISSIGYEIGSKLAAMCDDFDAQMMSYSAHASDRSLFHRLLDFFAF ced9_caeel Apoptosis regulator ced-9 Cell death protein 9 ced-9 T07C4.8 protein protein caeel Caenorhabditis elegans MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRMSIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK ced_9-egl_1-2 The ced-9 protein interacts with the egl-1 protein 171338 N/A 171340 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 171341 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false ced-9-egl-1-3 The ced-9 protein interacts with the egl-1 protein 171338 N/A 171341 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 171340 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bh3 -like domain binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ced-9-egl-1-1 The ced-9 protein interacts with the egl-1 protein 171339 N/A 171340 unspecified role unspecified role prey prey N/A 171341 unspecified role unspecified role bait bait physical association physical association false false false