IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hsu-1997-2 ATAR, a novel tumor necrosis factor receptor family member, signals through TRAF2 and TRAF5. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hsu H., Solovyev I., Colombero A., Elliott R., Kelley M., Boyle WJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Directed yeast two hybrid hhsu@amgen.com J. Biol. Chem. (0021-9258) 1997 hsu-1997-1 ATAR, a novel tumor necrosis factor receptor family member, signals through TRAF2 and TRAF5. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid partial dna sequence hybrid partial dna sequence identification by hybridization partial dna sequence hybrid Hsu H., Solovyev I., Colombero A., Elliott R., Kelley M., Boyle WJ. Apoptosis - Interactions involving proteins with a function related to apoptosis hhsu@amgen.com J. Biol. Chem. (0021-9258) 1997 hsu-1997-3 ATAR, a novel tumor necrosis factor receptor family member, signals through TRAF2 and TRAF5. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Hsu H., Solovyev I., Colombero A., Elliott R., Kelley M., Boyle WJ. Apoptosis - Interactions involving proteins with a function related to apoptosis hhsu@amgen.com J. Biol. Chem. (0021-9258) 1997 traf2_mouse TNF receptor-associated factor 2 Traf2 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein mouse Mus musculus Mouse MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL tnr14_mouse Tumor necrosis factor receptor superfamily member 14 Tnfrsf14 Herpes virus entry mediator A Tumor necrosis factor receptor-like 2 hvem protein protein mouse Mus musculus Mouse MEPLPGWGSAPWSQAPTDNTFRLVPCVFLLNLLQRISAQPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIVGAGIAGFLICTRRHLHTSSVAKELEPFQEQQENTIRFPVTEVGFAETEEETASN traf5_mouse TNF receptor-associated factor 5 Traf5 protein protein mouse Mus musculus Mouse MAHSEEQAAVPCAFIRQNSGNSISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDLTDLEDL tnr14_human Tumor necrosis factor receptor superfamily member 14 TNFRSF14 HVEA HVEM UNQ329/PRO509 Herpes virus entry mediator A Tumor necrosis factor receptor-like 2 protein protein human Homo sapiens Human MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH q12933-2 TNF receptor-associated factor 2 TRAF2 TRAP3 E3 ubiquitin-protein ligase TRAF2 Tumor necrosis factor type 2 receptor-associated protein 3 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYEVKMPACGMVTEAPAVGSRPRSPSSYDLVLHVPLTGAEACLMSVEEETELLLRSCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL No experimental confirmation available. traf5_human TNF receptor-associated factor 5 RING finger protein 84 TRAF5 RNF84 protein protein human Homo sapiens Human MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL atar-traf2-4 Yeast-2-hybrid reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 2 protein (TRAF2) 175351 N/A 175354 unspecified role unspecified role prey prey N/A 175355 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false atar-traf5-2 Yeast-2-hybrid reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 5 protein (TRAF5) 175351 N/A 175356 unspecified role unspecified role prey prey N/A 175355 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false atar-traf2-6 Yeast-2-hybrid reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 2 protein (TRAF2) 175351 N/A 175357 unspecified role unspecified role bait bait region Intracellular domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 175358 unspecified role unspecified role prey prey physical association physical association false false false atar-traf5-3 Yeast-2-hybrid reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 5 protein (TRAF5) 175351 N/A 175359 unspecified role unspecified role prey prey N/A 175357 unspecified role unspecified role bait bait region Intracellular domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false atar-traf5-4 Yeast-2-hybrid reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 5 protein (TRAF5) 175351 N/A 175359 unspecified role unspecified role prey prey N/A 175357 unspecified role unspecified role bait bait region Intracellular domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q92956:p.Glu271Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false atar-traf2-9 Yeast-2-hybrid reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 2 protein (TRAF2) 175351 N/A 175357 unspecified role unspecified role bait bait Q92956:p.Glu271Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region Intracellular domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 175360 unspecified role unspecified role prey prey physical association physical association false false false atar-traf2 Yeast-2-hybrid reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 2 protein (TRAF2) 175352 N/A 175357 unspecified role unspecified role bait bait N/A 175358 unspecified role unspecified role prey prey physical association physical association false false false atar-traf2-1 Yeast-2-hybrid reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 2 protein (TRAF2) 175352 N/A 175357 unspecified role unspecified role bait bait intracellular domain Intracellular domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 175354 unspecified role unspecified role prey prey physical association physical association false false false atar-traf5 Yeast-2-hybrid reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 5 protein (TRAF5) 175352 N/A 175359 unspecified role unspecified role prey prey N/A 175357 unspecified role unspecified role bait bait intracellular domain Intracellular domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false atar-traf5-1 Yeast-2-hybrid reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 5 protein (TRAF5) 175352 N/A 175357 unspecified role unspecified role bait bait intracellular domain Intracellular domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 175356 unspecified role unspecified role prey prey physical association physical association false false false atar-traf5-5 Coimmunoprecipitation reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 5 protein (TRAF5) 175353 N/A 175357 unspecified role unspecified role bait bait N/A 175359 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false atar-traf2-11 Coimmunoprecipitation reveals interaction between the tumor necrosis factor receptor superfamily member 14 precursor protein (ATAR) and the TNF receptor associated factor 2 protein (TRAF2) 175353 N/A 175357 unspecified role unspecified role bait bait N/A 175358 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false