IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ boldin-1996-1 Involvement of MACH, a novel MORT1/FADD-interacting protease, in Fas/APO-1- and TNF receptor-induced cell death. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Boldin MP., Goncharov TM., Goltsev YV., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Time required for the double hybrid growth is reported for each interaction: A: growth within 30 minutes B: growth in 30 minutes - 2 hours time C: growth in 2 - 6 hours time Cell (0092-8674) 1996 boldin-1996-2 Involvement of MACH, a novel MORT1/FADD-interacting protease, in Fas/APO-1- and TNF receptor-induced cell death. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Boldin MP., Goncharov TM., Goltsev YV., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Time required for the double hybrid growth is reported for each interaction: A: growth within 30 minutes B: growth in 30 minutes - 2 hours time C: growth in 2 - 6 hours time The cell line used in the experiment is transformed human 293-EBNA (Epstein-Barr virus nuclear antigen) from Invitrogen. Cell (0092-8674) 1996 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS q14790-5 Caspase-8 CASP8 MCH5 Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog Beta-1 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNDFGQSLPNEKQTSGILSDHQQSQFCKSTGESAQTSQH q14790-1 Caspase-8 CASP8 MCH5 Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog Alpha-1 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD fadd-fadd-2 homodimerisation of Fadd by 2 hybrid 176671 N/A 176673 unspecified role unspecified role bait bait N/A 176673 unspecified role unspecified role prey prey region possible binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A Fadd 1-79 fragments homodimerise with full lenght proteins but not with identical fragments. A fadd-fadd-3 homodimerisation of Fadd by 2 hybrid 176671 N/A 176673 unspecified role unspecified role bait bait region possible binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 176673 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A Fadd 1-79 fragments homodimerise with full lenght proteins but not with identical fragments. A casp8b1-fadd-1 Fadd interaction with Casp-8 beta1 detected by 2 hybrid 176671 N/A 176674 unspecified role unspecified role bait bait N/A 176673 unspecified role unspecified role prey prey region possible binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A A casp8b1-casp8b1-1 Homodimerisation of Casp-8 beta1 detected by 2 hybrid 176671 N/A 176674 unspecified role unspecified role bait bait N/A 176674 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A A fadd-casp8b1-1 Fadd interaction with Casp-8 beta1 detected by 2 hybrid 176671 N/A 176673 unspecified role unspecified role bait bait region possible binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 176674 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. A A casp8a1-casp8b1-1 dimerisation of Casp-8 beta1 and Casp-8 alfa1 detected by 2 hybrid 176671 N/A 176674 unspecified role unspecified role prey prey N/A 176675 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B B casp8a1-fadd-1 Fadd interaction with Casp-8 alfa1 detected by 2 hybrid 176671 N/A 176675 unspecified role unspecified role bait bait Q14790-1:p.Cys360Ser mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 176673 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. The point mutation on casp8 alfa-1 upgrade the interaction from C to A Wild type Casp8 alfa 1 is cytotoxic while the non catalytic point mutant is not. The point mutation on casp8 alfa-1 upgrade the interaction from C to A casp8a1-fadd-2 Fadd interaction with Casp-8 alfa1 detected by 2 hybrid 176671 N/A 176675 unspecified role unspecified role bait bait Q14790-1:p.Cys360Ser required mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 176673 unspecified role unspecified role prey prey region possible binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B The interaction is detected only with the Casp8 alfa-1 point mutant construct. B casp8b1-casp8a1-1 dimerisation of Casp-8 beta1 and Casp-8 alfa1 detected by 2 hybrid 176671 N/A 176674 unspecified role unspecified role bait bait N/A 176675 unspecified role unspecified role prey prey Q14790-1:p.Cys360Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. The point mutation on casp8 alfa-1 upgrade de interaction from B to A Wild type casp8 alfa-1 is cytotoxic while the non catalytic mutant is not The point mutation on casp8 alfa-1 upgrade de interaction from B to A fadd-casp8a1-1 Fadd interaction with Casp-8 alfa1 detected by 2 hybrid 176671 N/A 176673 unspecified role unspecified role bait bait N/A 176675 unspecified role unspecified role prey prey Q14790-1:p.Cys360Ser mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. The point mutation on casp8 alfa-1 upgrade the interaction from B to A Wild type Casp8 alfa 1 is cytotoxic while the non catalytic point mutant is not. The point mutation on casp8 alfa-1 upgrade the interaction from B to A fadd-casp8a1-2 Fadd interaction with Casp-8 alfa1 detected by 2 hybrid 176671 N/A 176675 unspecified role unspecified role prey prey Q14790-1:p.Cys360Ser mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 176673 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. The point mutation on casp8 alfa-1 upgrade the interaction from C to A Wild type Casp8 alfa 1 is cytotoxic while the non catalytic point mutant is not. The point mutation on casp8 alfa-1 upgrade the interaction from C to A casp8a1-casp8a1-1 homodimerisation of Casp-8 alfa1 detected by 2 hybrid 176671 N/A 176675 unspecified role unspecified role bait bait N/A 176675 unspecified role unspecified role prey prey Q14790-1:p.Cys360Ser required mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. C The interaction is not detected when bait and prey are the cytotoxic wild type Casp8 alfa1 C casp8a1-casp8a1-2 homodimerisation of Casp-8 alfa1 detected by 2 hybrid 176671 N/A 176675 unspecified role unspecified role prey prey N/A 176675 unspecified role unspecified role bait bait Q14790-1:p.Cys360Ser required mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. B The interaction is not detected when bait and prey are the cytotoxic wild type Casp8 alfa-1 B fadd-casp8b1-2 interaction of Fadd with Casp-8 beta1 detected by coip 176672 N/A 176674 unspecified role unspecified role prey prey N/A 176673 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false fadd-casp8-1 interaction of Fadd with Casp-8 alfa 1and Casp-8 beta 1 splice variants detected by coip 176672 N/A 176675 unspecified role unspecified role prey prey Q14790-1:p.Cys360Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 176673 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 176674 unspecified role unspecified role prey prey association association false false false