IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ganchi-1993-3 A novel NF-kappa B complex containing p65 homodimers: implications for transcriptional control at the level of subunit dimerization. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ganchi PA., Sun SC., Greene WC., Ballard DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Complexes treated with anti-p65 prior to electrophoresis. This caused a shift in migration due to antibody binding. Deoxycholate added to samples to dissociate I-kappaB. 32P-labelled DNA added to reaction mixture and gels visulaised by autoradiography. 1B & 1C Mol. Cell. Biol. (0270-7306) 1993 ganchi-1993-1 A novel NF-kappa B complex containing p65 homodimers: implications for transcriptional control at the level of subunit dimerization. human-jurkat Homo sapiens jurkat Human T cell leukemia comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel antibody detection identification by antibody antibody detection Ganchi PA., Sun SC., Greene WC., Ballard DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Complexes treated with anti-p65 prior to electrophoresis. This caused a shift in migration due to antibody binding. Deoxycholate added to samples to dissociate I-kappaB. 32P-labelled DNA added to reaction mixture and gels visulaised by autoradiography. 1B & 1C Mol. Cell. Biol. (0270-7306) 1993 ganchi-1993-2 A novel NF-kappa B complex containing p65 homodimers: implications for transcriptional control at the level of subunit dimerization. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel antibody detection identification by antibody antibody detection Ganchi PA., Sun SC., Greene WC., Ballard DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Complexes treated with anti-p65 prior to electrophoresis. This caused a shift in migration due to antibody binding. Deoxycholate added to samples to dissociate I-kappaB. 32P-labelled DNA added to reaction mixture and gels visulaised by autoradiography. 1B & 1C Mol. Cell. Biol. (0270-7306) 1993 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 ikka_human Inhibitor of nuclear factor kappa-B kinase subunit alpha CHUK IKKA TCF16 I-kappa-B kinase 1 Conserved helix-loop-helix ubiquitous kinase Nuclear factor NF-kappa-B inhibitor kinase alpha Transcription factor 16 protein protein human Homo sapiens Human MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCHEIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPIIQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE kappab enhancer Interleulin-2 receptor alpha kappaB enhancer dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid in vitro In vitro CAACGGCAGGGAATTCCCCTCTCCTT rela-rela-3 Homodimerization of RelA (NF-KB p65) identified by coimunoprecipitation 219374 N/A 219377 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 219377 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q04206:p.Cys216Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false 219387 219383 physical association physical association false false false nfkb1_p50-rela-2 Interaction of RelA (NF-KB p65) with NFKB1 p50 chain identified by coimmunoprecipitation 219374 N/A 219377 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 219378 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false rela-chuk-1 Interaction of RelA (NF-KB p65) with I-kappaB alpha identified by coimmunoprecipitation 219374 N/A 219377 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 219379 unspecified role unspecified role prey prey physical association physical association false false false rela-rela-1 Homodimerization of RelA (NF-KB p65) identified by gel electrophoresis 219375 N/A 219377 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 N/A 219380 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 physical association physical association false false false Complex only appears in the nucleus following pre-treatment of cells with phorbol ester nfkb1_p50-rela-1 Interaction of RelA (NF-KB p65) with NFKB1 p50 chain identified by gel electrophoresis 219375 N/A 219380 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 N/A 219378 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 N/A 219377 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 N/A 219380 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 physical association physical association false false false Complex only appears in the nucleus following pre-treatment of cells with phorbol ester rela-rela-2 Homodimerization of RelA (NF-KB p65) identified by gel electrophoresis 219376 N/A 219380 unspecified role unspecified role neutral component neutral component N/A 219377 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false Complex only appears in the nucleus following pre-treatment of cells with phorbol ester nfkb1_p50-rela-4 Interaction of RelA (NF-KB p65) with NFKB1 p50 chain identified by gel electrophoresis 219376 N/A 219380 unspecified role unspecified role neutral component neutral component N/A 219377 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 N/A 219378 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 physical association physical association false false false Complex only appears in the nucleus following pre-treatment of cells with phorbol ester