IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ monsalve-2013-1 Human VRK2 modulates apoptosis by interaction with Bcl-xL and regulation of BAX gene expression human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Apoptosis - Interactions involving proteins with a function related to apoptosis 2012-12-05: P Lazo, Instituto de Biología Molecular y Celular del Cáncer, Centro de Investigación del Cáncer (CIC), Consejo Superior de Investigaciones Científicas (CSIC), Universidad de Salamanca plazozbi@usal.es plazozbi@usal.es,pedro.lazo@csic.es 2013 Only protein-protein interactions imex curation Monsalve DM., Merced T., Fernández IF., Blanco S., Vázquez-Cedeira M., Lazo PA. Cell death & disease monsalve-2013-2 Human VRK2 modulates apoptosis by interaction with Bcl-xL and regulation of BAX gene expression human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down western blot western blot Immuno blot Immuno blot Apoptosis - Interactions involving proteins with a function related to apoptosis 2012-12-05: P Lazo, Instituto de Biología Molecular y Celular del Cáncer, Centro de Investigación del Cáncer (CIC), Consejo Superior de Investigaciones Científicas (CSIC), Universidad de Salamanca plazozbi@usal.es plazozbi@usal.es,pedro.lazo@csic.es 2013 Only protein-protein interactions imex curation Monsalve DM., Merced T., Fernández IF., Blanco S., Vázquez-Cedeira M., Lazo PA. Cell death & disease q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK vrk2_human Serine/threonine-protein kinase VRK2 VRK2 Vaccinia-related kinase 2 protein protein human Homo sapiens Human MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKISYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLSEETNADVYYYRIIIPVLLMLVFLALFFL bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG q86y07-1 Serine/threonine-protein kinase VRK2 VRK2 Vaccinia-related kinase 2 VRK2A protein protein human Homo sapiens Human MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKISYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLSEETNADVYYYRIIIPVLLMLVFLALFFL bcl2l1-vrk2 1353514 n/a Bcl-xL 1353516 unspecified role unspecified role neutral component neutral component n/a VRK2 1353517 unspecified role unspecified role unspecified role unspecified role colocalization colocalization false false false 1a bcl2l1-vrk2-2 1353514 n/a Bax 1353518 unspecified role unspecified role neutral component neutral component n/a VRK2 1353517 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1b vrk2-bcl2l1 1353515 n/a Bcl-xL 1353516 unspecified role unspecified role prey prey n/a VRK2A 1353519 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1c and 1d vrk2-bax 1353515 n/a VRK2A 1353519 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a Bcl-xL 1353516 unspecified role unspecified role prey prey n/a 1353518 unspecified role unspecified role prey prey n-terminal au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false 2a-c