IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chunhacha-2012-1 Caveolin-1 regulates Mcl-1 stability and anoikis in lung carcinoma cells. human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chunhacha P., Pongrakhananon V., Rojanasakul Y., Chanvorachote P. Apoptosis - Interactions involving proteins with a function related to apoptosis pithi_chan@yahoo.com The experiment was performed in both the wild-type H460 cell line and in a stably transfected line expressing high amounts of YFP-tagged caveolin. Am. J. Physiol., Cell Physiol. (0363-6143) 2012 Only protein-protein interactions imex curation The experiment was performed in both the wild-type H460 cell line and in a stably transfected line expressing high amounts of YFP-tagged caveolin. chunhacha-2012-2 Caveolin-1 regulates Mcl-1 stability and anoikis in lung carcinoma cells. human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 confocal microscopy confocal microscopy immunostaining immunostaining Chunhacha P., Pongrakhananon V., Rojanasakul Y., Chanvorachote P. Apoptosis - Interactions involving proteins with a function related to apoptosis pithi_chan@yahoo.com The experiment was performed in both the wild-type H460 cell line and in a stably transfected line expressing high amounts of YFP-tagged caveolin. Am. J. Physiol., Cell Physiol. (0363-6143) 2012 Only protein-protein interactions imex curation The experiment was performed in both the wild-type H460 cell line and in a stably transfected line expressing high amounts of YFP-tagged caveolin. cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR cav1_mouse Caveolin-1 Cav1 Cav protein protein mouse Mus musculus Mouse MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI cav1-mcl1-1 1308479 n/a 1308481 unspecified role unspecified role bait bait n/a 1308482 unspecified role unspecified role prey prey physical association physical association false false false 3b mcl1-cav1 1308479 n/a 1308482 unspecified role unspecified role bait bait n/a 1308481 unspecified role unspecified role prey prey physical association physical association false false false 3b mcl1-cav1-1 1308479 n/a 1308482 unspecified role unspecified role bait bait n/a 1308483 unspecified role unspecified role prey prey c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3b Interaction detected in the HCav-1 cell line, expressing large amounts of YFP-tagged caveolin. cav1-mcl1-2 1308479 n/a 1308483 unspecified role unspecified role bait bait c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1308482 unspecified role unspecified role prey prey physical association physical association false false false 3b Interaction detected in the HCav-1 cell line, expressing large amounts of YFP-tagged caveolin. cav1-mcl1-3 1308480 n/a 1308482 unspecified role unspecified role neutral component neutral component n/a 1308483 unspecified role unspecified role neutral component neutral component c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false 3d cav1-mcl1-4 1308480 n/a 1308481 unspecified role unspecified role neutral component neutral component n/a 1308482 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3c and 3d