IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bertrand-2011-1 cIAP1/2 Are Direct E3 Ligases Conjugating Diverse Types of Ubiquitin Chains to Receptor Interacting Proteins Kinases 1 to 4 (RIP1-4). in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bertrand M.J., Lippens S., Staes A., Gilbert B., Roelandt R., De Medts J., Gevaert K., Declercq W., Vandenabeele P. Apoptosis - Interactions involving proteins with a function related to apoptosis Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease Source of BIRC2 and BIRC3 inferred by mutant mapping mathieu.bertrand@dmbr.vib-ugent.be PLoS ONE 2011 Only protein-protein interactions imex curation bertrand-2011-3 cIAP1/2 Are Direct E3 Ligases Conjugating Diverse Types of Ubiquitin Chains to Receptor Interacting Proteins Kinases 1 to 4 (RIP1-4). in vitro In vitro enzymatic study enzymatic study weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bertrand M.J., Lippens S., Staes A., Gilbert B., Roelandt R., De Medts J., Gevaert K., Declercq W., Vandenabeele P. Apoptosis - Interactions involving proteins with a function related to apoptosis Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease This was a ubiquitination reaction, performed in vitro using human recombinant ubiquitin. Source of BIRC2 and BIRC3 inferred by mutant mapping mathieu.bertrand@dmbr.vib-ugent.be PLoS ONE 2011 Only protein-protein interactions imex curation bertrand-2011-2 cIAP1/2 Are Direct E3 Ligases Conjugating Diverse Types of Ubiquitin Chains to Receptor Interacting Proteins Kinases 1 to 4 (RIP1-4). human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bertrand M.J., Lippens S., Staes A., Gilbert B., Roelandt R., De Medts J., Gevaert K., Declercq W., Vandenabeele P. Apoptosis - Interactions involving proteins with a function related to apoptosis Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease Source of BIRC2 and BIRC3 inferred by mutant mapping mathieu.bertrand@dmbr.vib-ugent.be PLoS ONE 2011 Only protein-protein interactions imex curation birc2_human Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 TNFR2-TRAF-signaling complex protein 2 IAP homolog B RING finger protein 48 BIRC2 API1 MIHB RNF48 RING-type E3 ubiquitin transferase BIRC2 Cellular inhibitor of apoptosis 1 protein protein human Homo sapiens Human MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN ripk2_human Receptor-interacting serine/threonine-protein kinase 2 RIPK2 CARDIAK RICK RIP2 UNQ277/PRO314/PRO34092 RIP-like-interacting CLARP kinase Receptor-interacting protein 2 CARD-containing interleukin-1 beta-converting enzyme-associated kinase Tyrosine-protein kinase RIPK2 protein protein human Homo sapiens Human MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM birc3_human Baculoviral IAP repeat-containing protein 3 Inhibitor of apoptosis protein 1 TNFR2-TRAF-signaling complex protein 1 IAP homolog C Apoptosis inhibitor 2 RING finger protein 49 BIRC3 API2 MIHC RNF49 RING-type E3 ubiquitin transferase BIRC3 Cellular inhibitor of apoptosis 2 protein protein human Homo sapiens Human MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESSIIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDLLNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHDVIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS ripk3_human Receptor-interacting serine/threonine-protein kinase 3 RIPK3 RIP3 RIP-like protein kinase 3 Receptor-interacting protein 3 protein protein human Homo sapiens Human MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNRQNRPSLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVSTVKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK ripk4_human Receptor-interacting serine/threonine-protein kinase 4 RIPK4 ANKRD3 DIK Ankyrin repeat domain-containing protein 3 PKC-delta-interacting protein kinase protein protein human Homo sapiens Human MEGDGGTPWALALLRTFDAGEFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNGLNGELIRQVLAALLPVTGRWRSPGEGFRLESEVIIRVTCPLSSPQEITSETEDLCEKPDDEVKETAHDLDVKSPPEPRSEVVPARLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRSSSESKLPSSGSGKRLSGVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVDLALDSGASLLHLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLARKISVNAKDEDQWTALHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT ub2d1_human Ubiquitin-conjugating enzyme E2 D1 Ubiquitin-protein ligase D1 Ubiquitin carrier protein D1 UbcH5 Ubiquitin-conjugating enzyme E2-17 kDa 1 Ubiquitin-conjugating enzyme E2(17)KB 1 UBC4/5 homolog Stimulator of Fe transport UBE2D1 UBCH5 UBCH5A SFT UBC5A (E3-independent) E2 ubiquitin-conjugating enzyme D1 E2 ubiquitin-conjugating enzyme D1 protein protein human Homo sapiens Human MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM birc2-ripk1-2 1188539 n/a 1188542 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188543 unspecified role unspecified role prey prey cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 1a, 1b SMAC mimetic compound BV6 disrupts this interaction. birc2-ripk2 1188539 n/a 1188542 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188544 unspecified role unspecified role unspecified role unspecified role cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 1a, 1b SMAC mimetic compound BV6 disrupts this interaction. birc3-ripk2 1188539 n/a 1188545 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188544 unspecified role unspecified role prey prey cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 1a, 1b SMAC mimetic compound BV6 disrupts this interaction. birc3-ripk1-2 1188539 n/a 1188543 unspecified role unspecified role prey prey cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188545 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1a, 1b SMAC mimetic compound BV6 disrupts this interaction. xiap-ripk1 1188539 n/a 1188543 unspecified role unspecified role prey prey cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188546 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1a, 1b xiap-ripk2 1188539 n/a 1188546 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188544 unspecified role unspecified role prey prey cell lysate cell lysate vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 1a, 1b xiap-ripk3 1188539 n/a 1188546 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188547 unspecified role unspecified role prey prey cell lysate cell lysate vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 1a, 1b birc2-ripk3 1188539 n/a 1188542 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188547 unspecified role unspecified role prey prey cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 1a, 1b birc3-ripk3 1188539 n/a 1188545 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188547 unspecified role unspecified role prey prey cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 1a, 1b xiap-ripk4 1188539 n/a 1188548 unspecified role unspecified role prey prey cell lysate cell lysate vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188546 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1a, 1b birc3-ripk4 1188539 n/a 1188545 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188548 unspecified role unspecified role prey prey cell lysate cell lysate vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 1a, 1b birc2-ripk4 1188539 n/a 1188548 unspecified role unspecified role prey prey cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188542 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1a, 1b birc2-ripk1-4 1188540 n/a 1188549 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) n/a 1188543 enzyme target enzyme target substrate substrate unspecified role unspecified role cell lysate cell lysate vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188542 enzyme enzyme unspecified role unspecified role purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) ubiquitination ubiquitination reaction ubiquitination false false false Q13490 is required for ubiquitination of Q13546 2a, 3b, 3c and 3d The ubiquitylation assay tested positive for different types of ubiqutylation: K48 and K63 chains (fig. 3b), head and tail ubiquitylation (fig. 3c) and mono-ubiquitylation (fig. 3d). birc3-ripk2-2 1188540 n/a 1188544 enzyme target enzyme target substrate substrate unspecified role unspecified role cell lysate cell lysate vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188545 enzyme enzyme unspecified role unspecified role purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188549 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) ubiquitination ubiquitination reaction ubiquitination false false false Q13489 is required for ubiquitination of O43353 2a birc3-ripk1-4 1188540 n/a 1188543 enzyme target enzyme target substrate substrate unspecified role unspecified role cell lysate cell lysate vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188549 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) n/a 1188545 enzyme enzyme unspecified role unspecified role purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) ubiquitination ubiquitination reaction ubiquitination false false false Q13489 is required for ubiquitination of Q13546 2a birc2-ripk2-3 1188540 n/a 1188549 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) n/a 1188544 enzyme target enzyme target substrate substrate unspecified role unspecified role cell lysate cell lysate vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188542 enzyme enzyme unspecified role unspecified role purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) ubiquitination ubiquitination reaction ubiquitination false false false Q13490 is required for ubiquitination of O43353 2a, 3b, 3c and 3d The ubiquitylation assay tested positive for different types of ubiqutylation: K48 and K63 chains (fig. 3b), head and tail ubiquitylation (fig. 3c) and mono-ubiquitylation (fig. 3d). birc2-ripk3-3 1188540 n/a 1188542 enzyme enzyme unspecified role unspecified role purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188549 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) n/a 1188547 enzyme target enzyme target substrate substrate unspecified role unspecified role cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes ubiquitination ubiquitination reaction ubiquitination false false false Q13490 is required for ubiquitination of Q9Y572 2a, 3b, 3c and 3d The ubiquitylation assay tested positive for different types of ubiqutylation: K48 and K63 chains (fig. 3b), head and tail ubiquitylation (fig. 3c) and mono-ubiquitylation (fig. 3d). birc3-ripk3-2 1188540 n/a 1188545 enzyme enzyme unspecified role unspecified role purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188549 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) n/a 1188547 enzyme target enzyme target substrate substrate unspecified role unspecified role cell lysate cell lysate vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes ubiquitination ubiquitination reaction ubiquitination false false false Q13489 is required for ubiquitination of Q9Y572 2a birc3-ripk4-2 1188540 n/a 1188548 enzyme target enzyme target substrate substrate unspecified role unspecified role cell lysate cell lysate vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188545 enzyme enzyme unspecified role unspecified role purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188549 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) ubiquitination ubiquitination reaction ubiquitination false false false Q13489 is required for ubiquitination of P57078 2a birc2-ripk4-2 1188540 n/a 1188549 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) n/a 1188548 enzyme target enzyme target substrate substrate unspecified role unspecified role cell lysate cell lysate P57078:p.Lys51Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P57078:p.Lys145Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188542 enzyme enzyme unspecified role unspecified role purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) ubiquitination ubiquitination reaction ubiquitination false false false Q13490 is required for ubiquitination of P57078 2a, 3b, 3c, 3d and 5d The ubiquitylation assay tested positive for different types of ubiqutylation: K48 and K63 chains (fig. 3b), head and tail ubiquitylation (fig. 3c) and mono-ubiquitylation (fig. 3d). xiap-ripk4-1 1188540 n/a 1188546 enzyme enzyme unspecified role unspecified role purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1188548 enzyme target enzyme target substrate substrate unspecified role unspecified role cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes n/a 1188549 unspecified role unspecified role ancillary ancillary purified purified ecoli Escherichia coli (strain K12) ubiquitination ubiquitination reaction ubiquitination false false false P98170 is required for ubiquitination of P57078 2a birc2-ripk1-3 1188541 n/a 1188543 unspecified role unspecified role prey prey vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188542 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1c birc2-ripk2-2 1188541 n/a 1188542 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188544 unspecified role unspecified role prey prey vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1c birc2-ripk3-1 1188541 n/a 1188547 unspecified role unspecified role prey prey vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188542 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1c birc3-ripk1-3 1188541 n/a 1188545 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188543 unspecified role unspecified role prey prey vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1d and S1 birc2-ripk4-1 1188541 n/a 1188548 unspecified role unspecified role prey prey vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188542 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1c birc3-ripk2-3 1188541 n/a 1188544 unspecified role unspecified role prey prey vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188545 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1d and S1 birc3-ripk3-3 1188541 n/a 1188547 unspecified role unspecified role prey prey vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188545 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S1, 2b and 1d birc3-ripk4-3 1188541 n/a 1188548 unspecified role unspecified role prey prey vsv tag vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1188545 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S1, 2b and 1d