IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yuan-2011-2 The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu Structure (0969-2126) 2011 Only protein-protein interactions imex curation yuan-2011-3 The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Caspase-3 taken from previous work of contidutor (PMID: 19788411) cakey@bu.edu Structure (0969-2126) 2011 Only protein-protein interactions imex curation yuan-2011-1 The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation ms participant Identification by mass spectrometry ms participant Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu Structure (0969-2126) 2011 Only protein-protein interactions imex curation yuan-2011-4 The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis The cleavage reaction was performed, thrombin-digested and then the components were separated in a glycerol gradient to determine which of those were co-migrating (binding). cakey@bu.edu Structure (0969-2126) 2011 Only protein-protein interactions imex curation yuan-2011-5 The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. in vitro In vitro protease access protease accessibility laddering pal pal protease access weight by staining molecular weight estimation by staining weight by staining Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu Structure (0969-2126) 2011 Only protein-protein interactions imex curation cyc_bovin Cytochrome c CYCS CYC protein protein bovin Bos taurus (Bovine) Bovine MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE apaf_human Apoptotic protease-activating factor 1 APAF1 KIAA0413 protein protein human Homo sapiens Human MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVPQRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINKKNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGSSDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHHSTIQYCDFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTSSDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLTEAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLISSSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKDFVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDSTLLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE casp9_human Caspase-9 ICE-like apoptotic protease 6 Apoptotic protease Mch-6 Apoptotic protease-activating factor 3 CASP9 MCH6 protein protein human Homo sapiens Human MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS casp3_human Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 CASP3 CPP32 protein protein human Homo sapiens Human MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH apaf1-casp9-26 1174590 n/a 1174595 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] n/a 1174596 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 1174597 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false casp9 without card region experimental feature experimental feature range range certain certain sequence position certain false P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 1a, 1b and 1c apaf1-casp9-24 1174590 n/a 1174595 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] n/a 1174597 unspecified role unspecified role neutral component neutral component purified purified casp9 without card region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false deletion 30l sufficient to bind sufficient binding region sufficient to bind n-term range n-terminal range n-term range certain certain sequence position certain false certain certain sequence position certain c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1174596 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. physical association physical association false false false 3E apaf1-casp9-25 1174590 n/a 1174595 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] n/a 1174596 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 1174597 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 5a-e, S5b, S6a and S6b apaf1-casp9-27 1174590 n/a 1174595 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] n/a 1174597 unspecified role unspecified role neutral component neutral component purified purified P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false casp9 without card region experimental feature experimental feature range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1174596 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. physical association physical association false false false 6a-d apaf1-casp3-7 1174591 n/a 1174595 unspecified role unspecified role ancillary ancillary purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] n/a 1174597 enzyme enzyme neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false thrombin site uncategorized protein modification uncategorized protein modification certain certain sequence position certain certain certain sequence position certain false P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1174598 enzyme target enzyme target substrate substrate neutral component neutral component purified purified P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1174596 unspecified role unspecified role ancillary ancillary purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. cleavage cleavage reaction cleavage false false false 3d Procaspase-9 has a potential linker of approximately 69 residues between the CARD and p20 domain, reducing the size of this linker reduced the catalytic activity of Caspase-9. apaf1-casp3-6 1174591 n/a 1174595 unspecified role unspecified role ancillary ancillary purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] n/a 1174596 unspecified role unspecified role ancillary ancillary purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 1174597 enzyme enzyme neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false thrombin site uncategorized protein modification uncategorized protein modification certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1174598 enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage false false false 4a Caspase-9 asp315ala displays significantly reduced cleavage activity. apaf1-casp3-8 1174591 n/a 1174597 enzyme enzyme neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false thrombin site uncategorized protein modification uncategorized protein modification certain certain sequence position certain certain certain sequence position certain false P55211:p.Asp315Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1174598 enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1174595 unspecified role unspecified role ancillary ancillary purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] n/a 1174596 unspecified role unspecified role ancillary ancillary purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. cleavage cleavage reaction cleavage false false false 4a The Caspase-9 asp315ala mutation in the p20-p10 linker has a significant effect on the final level of pc-9 activation apaf1-casp9-22 1174592 n/a 1174596 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. Stoichiometry: 10.0 n/a 1174597 unspecified role unspecified role neutral component neutral component purified purified P55211:p.[Glu306Ala;Asp315Ala;Asp330Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false thrombin site uncategorized protein modification uncategorized protein modification certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 8.0 n/a 1174595 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] Stoichiometry: 16.0 physical association physical association false false false S2b and S2c apaf1-casp9-23 1174592 n/a 1174595 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] Stoichiometry: 12.0 n/a 1174596 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. Stoichiometry: 10.0 n/a 1174597 unspecified role unspecified role neutral component neutral component purified purified tev cleaving site uncategorized protein modification uncategorized protein modification certain certain sequence position certain range range false P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 8.0 physical association physical association false false false S2a and S2c apaf1-casp3-9 1174593 n/a 1174595 unspecified role unspecified role ancillary ancillary purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] n/a 1174597 enzyme enzyme neutral component neutral component purified purified card region cleaved sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain range range false P55211:p.Asp315Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1174598 enzyme target enzyme target substrate substrate neutral component neutral component purified purified P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1174596 unspecified role unspecified role ancillary ancillary purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. cleavage cleavage reaction cleavage false false false 7a and 7b Unprocessed casp3 does not bind to the casp9-apaf1 complex. Thrombin cleavage of casp9-card region was performed before casp3 addition, showing that unprocessed casp3 does not bind to the apaf1 platform without processing. apaf1-casp3-10 1174593 n/a 1174595 unspecified role unspecified role ancillary ancillary purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] n/a 1174597 enzyme enzyme neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false card region cleaved sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false ecoli Escherichia coli (strain K12) n/a 1174596 unspecified role unspecified role ancillary ancillary purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 1174598 enzyme target enzyme target substrate substrate neutral component neutral component purified purified P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage false false false 7c In this variation of the experiment, casp3 was added before thrombin cleavage and removal of casp9-card region, showing that processed casp3 binds directly to the apaf1 platform. apaf1-casp3-12 1174594 n/a 1174595 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] n/a 1174596 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 1174597 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false thrombin site uncategorized protein modification uncategorized protein modification certain certain sequence position certain certain certain sequence position certain false P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1174598 unspecified role unspecified role neutral component neutral component purified purified P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 7d