IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kim-2011b-1 Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation kim-2011b-3 Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation kim-2011b-2 Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation kim-2011b-4 Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation kim-2011b-5 Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation kim-2011b-6 Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. human-pc3m Human PC3M Caucasian prostate adenocarcinoma pc3m Human PC3M Caucasian prostate adenocarcinoma PC-3M was isolated from a liver metastasis produced by the intrasplenic injection of human PC-3 prostate cancer cells into nude mice. PC-3M cells have "Hyperactive Akt" and are PTEN null. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation p10909-4 Clusterin nCLU CLU APOJ CLI KUB1 Aging-associated gene 4 protein Apolipoprotein J Complement cytolysis inhibitor Complement-associated protein SP-40,40 Ku70-binding protein 1 NA1/NA2 Testosterone-repressed prostate message 2 AAG4 Sulfated glycoprotein 2 protein protein human Homo sapiens Human MSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE Minor isoform that has been detected in a breast cancer cell line, but not in any other tissues or cell lines (Ref.29). Not glycosylated. Not detected in unstressed cells. Detectable at low level in stressed cells (Ref.3). q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG clus_human Clusterin CLU APOJ CLI KUB1 Complement-associated protein SP-40,40 Complement cytolysis inhibitor NA1/NA2 Apolipoprotein J Testosterone-repressed prostate message 2 Ku70-binding protein 1 Aging-associated gene 4 protein AAG4 Sulfated glycoprotein 2 protein protein human Homo sapiens Human MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE clu-bcl2l1 1173312 n/a 1173318 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n/a 1173319 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1e bcl2l1-bax 1173312 n/a 1173320 unspecified role unspecified role prey prey n/a 1173319 unspecified role unspecified role bait bait physical association physical association false false false Overexpressed nClu (P10909-4) disrupted this interaction. 1f bcl2l1-clu-1 1173313 n/a 1173319 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1173318 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3b clu-bcl2l1-4 1173313 n/a 1173318 unspecified role unspecified role bait bait P10909-4:p.Ser323Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1173319 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5b and 5c bcl2l1-clu-3 1173314 n/a 1173318 unspecified role unspecified role neutral component neutral component n/a 1173319 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1h clu-bcl2l1-1 1173315 n/a 1173318 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false leu323ala required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1173319 unspecified role unspecified role prey prey gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 3c and 5d clu-bcl2l1-5 1173316 n/a 1173321 unspecified role unspecified role bait bait n/a 1173319 unspecified role unspecified role prey prey physical association physical association false false false 7c clu-bcl2l1-3 1173317 n/a 1173318 unspecified role unspecified role bait bait n/a 1173319 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false S3b