IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2011h-4 Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation li-2011h-1 Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation li-2011h-2 Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation li-2011h-3 Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells confocal microscopy confocal microscopy immunostaining immunostaining Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation li-2011h-5 Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis The phosphorylation was detected in parallel with antibodies that could ascertain Thr- and Ser-specific phosphorylation. Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation casp7_human Caspase-7 ICE-like apoptotic protease 3 Apoptotic protease Mch-3 CMH-1 CASP7 MCH3 protein protein human Homo sapiens Human MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ pak2_human Serine/threonine-protein kinase PAK 2 p21-activated kinase 2 Gamma-PAK PAK65 S6/H4 kinase p58 PAK2 protein protein human Homo sapiens Human MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR casp7-pak2-1 1253769 n/a 1253774 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified P55210:p.[Ser30Ala;Thr173Ala;Ser239Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1253775 enzyme enzyme unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) 1253781 1253783 phosphorylation phosphorylation reaction phosphorylation false false false 2d and 3d casp7-pak2-3 1253769 n/a 1253775 enzyme enzyme unspecified role unspecified role purified purified t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1253774 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified peptide phosphorylation site ser239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false peptide phosphorylation site thr173 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false peptide phosphorylation site ser30 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation false false false 3c and 3b pak2-pak2-10 1253769 n/a 1253775 putative self putative self putative self putative self purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false 3d pak2-casp7 1253770 n/a 1253775 unspecified role unspecified role bait bait v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1253774 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2a pak2-casp7-1 1253771 n/a 1253774 unspecified role unspecified role prey prey n/a 1253775 unspecified role unspecified role bait bait physical association physical association false false false 2b casp7-pak2-4 1253772 n/a 1253774 unspecified role unspecified role neutral component neutral component n/a 1253775 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2c The colocalization is detected in cytoplasm. Upon treatment with staurosporine (induces apoptosis), the colocalization is restricted to the nucleus. casp7-pak2-2 1253773 n/a 1253775 enzyme enzyme unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1253774 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 3a