IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lazaridis-2011-1 Neurosteroid dehydroepiandrosterone interacts with nerve growth factor (NGF) receptors, preventing neuronal apoptosis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lazaridis I., Charalampopoulos I., Alexaki V.I., Avlonitis N., Pediaditakis I., Efstathopoulos P., Calogeropoulou T., Castanas E., Gravanis A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origins of TRAF6, RIPK2 and ARHGDIA were given by the authors upon email request. gravanis@med.uoc.gr PLoS Biol. (1544-9173) 2011 Only protein-protein interactions imex curation lazaridis-2011-2 Neurosteroid dehydroepiandrosterone interacts with nerve growth factor (NGF) receptors, preventing neuronal apoptosis. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lazaridis I., Charalampopoulos I., Alexaki V.I., Avlonitis N., Pediaditakis I., Efstathopoulos P., Calogeropoulou T., Castanas E., Gravanis A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origins of TRAF6, RIPK2 and ARHGDIA were given by the authors upon email request. gravanis@med.uoc.gr PLoS Biol. (1544-9173) 2011 Only protein-protein interactions imex curation ntrk1_rat High affinity nerve growth factor receptor Neurotrophic tyrosine kinase receptor type 1 p140-TrkA Slow nerve growth factor receptor Ntrk1 Trk Trka protein protein rat Rattus norvegicus (Rat) Rat MLRGQRHGQLGWHRPAAGLGGLVTSLMLACACAASCRETCCPVGPSGLRCTRAGTLNTLRGLRGAGNLTELYVENQRDLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFHFTPRLSHLNLSSNALESLSWKTVQGLSLQDLTLSGNPLHCSCALLWLQRWEQEDLCGVYTQKLQGSGSGDQFLPLGHNNSCGVPSVKIQMPNDSVEVGDDVFLQCQVEGQALQQADWILTELEGTATMKKSGDLPSLGLTLVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLGKAVEQHHWCIPFSVDGQPAPSLRWFFNGSVLNETSFIFTQFLESALTNETMRHGCLRLNQPTHVNNGNYTLLAANPYGQAAASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSRDPVEKKDETPFGVSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLAECYNLLNDQDKMLVAVKALKETSENARQDFHREAELLTMLQHQHIVRFFGVCTEGGPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDVHARLQALAQAPPSYLDVLG dhea-7-cmo Dehydroepiandrosterone-7-O-(carboxymethyl)oxime small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tnr16_mouse Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low affinity neurotrophin receptor p75NTR Low-affinity nerve growth factor receptor protein protein mouse Mus musculus Mouse MRRAGAACSAMDRLRLLLLLLLLLGVSFGGAKETCSTGMYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSYGYYQDEETGRCEACSVCGVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWITRSTPPEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVMGSSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV tnr16_rat Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein rat Rattus norvegicus (Rat) Rat MRRAGAACSAMDRLRLLLLLILGVSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDNVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEETGHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV gdir1_human Rho GDP-dissociation inhibitor 1 Rho-GDI alpha ARHGDIA GDIA1 protein protein human Homo sapiens Human MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD ripk2_human Receptor-interacting serine/threonine-protein kinase 2 RIPK2 CARDIAK RICK RIP2 UNQ277/PRO314/PRO34092 RIP-like-interacting CLARP kinase Receptor-interacting protein 2 CARD-containing interleukin-1 beta-converting enzyme-associated kinase Tyrosine-protein kinase RIPK2 protein protein human Homo sapiens Human MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM dhea_7_cmo-ntrk1-1 1186643 n/a 1186645 unspecified role unspecified role prey prey purified purified extracellular domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1186646 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 4a Free DHEA (CHEBI:16814) or NGF (Nerve Growth Factor) can disrupt the interaction. dhea_7_cmo-ngfr-1 1186643 n/a 1186646 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1186647 unspecified role unspecified role prey prey purified purified extracellular domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4a Free DHEA (CHEBI:16814) or NGF (Nerve Growth Factor) can disrupt the interaction. dhea_7_cmo-ntrk1-3 1186643 n/a 1186646 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1186645 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 4b dhea_7_cmo-ngfr-2 1186643 n/a 1186648 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1186646 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 4b dhea_7_cmo-ngfr-3 1186643 n/a 1186646 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1186648 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1186645 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 4b dhea_7_cmo-ngfr-4 1186643 n/a 1186645 unspecified role unspecified role prey prey cell lysate cell lysate rat-brain Rattus norvegicus brain brain Brain [cerebrum] n/a 1186646 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1186648 unspecified role unspecified role prey prey cell lysate cell lysate rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association false false false 4c dhea_7_cmo-ngfr-5 1186643 n/a 1186648 unspecified role unspecified role prey prey cell lysate cell lysate rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells n/a 1186645 unspecified role unspecified role prey prey cell lysate cell lysate rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells n/a 1186646 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 4c traf6-ngfr 1186644 n/a 1186649 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1186648 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5b arhgdia-ngfr 1186644 n/a 1186650 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1186648 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5b ripk2-ngfr 1186644 n/a 1186651 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1186648 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5b